KEGG   Leishmania major: LMJF_14_0510Help
Entry
LMJF_14_0510      CDS       T01014                                 

Definition
putative stearic acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
lma  Leishmania major
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lma00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    LMJF_14_0510
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    LMJF_14_0510
Enzymes [BR:lma01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     LMJF_14_0510
Lipid biosynthesis proteins [BR:lma01004]
 Desaturase
  First
   LMJF_14_0510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
14:complement(184088..185491)
Genome map
AA seq 467 aa AA seqDB search
MLQAVQNLFTCSVLSTDETKPKVEREVPQWSKGNFQYNWIGIYIIGVPLLFVLLGLYLRV
PLSFSLLQWLAFFAVVTGMVGVTTGYHRLFSHGAFTGGQAMQWVCAFVGAGAFQGSIKWW
ARNHRVHHKYTDTSKDPYDARRGFIFTHFGWFIMRMDYDLLGDADVSDLKDSLVVEFQRK
YFAAIATMTGILIPLMVAGATTGEWAGAFFWVVWLKIFLVHQFSFFINSLAHTDLFGATR
PYADNKTPHDSVVFAIINLGEGYHNYHHQFPNDYRNGHLWHHIDMTKWYIFMCSFLGFCD
NLQRAPRTVVDRAAAAQAVCMHGRKLQEAVEKVKQLEVPADKEYAWDDVRAEVEQGRKLL
VMDGYVLDLERPIPVDPAWAQKDKKISWLNMHPGGRALLLAYVGKDATAAFNGGVYGHTT
GAHNYLPELRVGRMKERPASSASGEEGSAAVCTGQCVTLPRRCDVPL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaggccgtgcagaacctcttcacctgcagcgtcctttccacggatgagacaaag
cccaaggtggagcgtgaggtgccgcagtggtcgaagggcaacttccagtacaactggatc
ggcatctacatcatcggtgtaccactgctgttcgtgctgcttgggttgtacctgcgcgtc
cctttatccttctcgcttctgcaatggcttgcattttttgccgttgtcaccggcatggtg
ggggtgacgaccggctatcatcgtctcttctcacacggtgctttcaccggcgggcaggcg
atgcagtgggtgtgcgccttcgtcggggcaggcgcgttccagggctctatcaagtggtgg
gctcgaaaccaccgcgtccaccacaagtacacggatacctccaaggacccgtacgacgcg
cgccgcggcttcatcttcacacactttggctggttcatcatgcgcatggactacgatctg
ctcggcgacgcagatgtgtcggacctgaaggacagcctcgttgtggagttccagcgcaag
tactttgccgccattgcgaccatgacagggatcctgatccccctcatggtggccggcgca
accactggtgagtgggcaggtgcgttcttctgggtggtgtggctcaagatctttctggtg
caccagttctccttcttcatcaacagcctcgcgcacacggacctctttggcgccacgcgg
ccgtacgcagataacaagacaccgcacgactccgtcgtctttgcgatcataaacctcggc
gagggctaccacaactaccaccaccagttcccgaacgactaccgtaacggtcatctgtgg
caccacattgatatgacaaagtggtacatatttatgtgcagctttctgggcttctgcgac
aacctgcagcgtgcgccgcgcactgtcgtcgaccgcgccgccgcggcgcaggctgtgtgc
atgcacgggcgcaaacttcaggaggcggtcgagaaggtgaagcagctggaggtgccggcg
gacaaggagtacgcgtgggacgacgtgcgggcggaagtggagcagggccgtaagctgctg
gtgatggacggctacgtgctggacctcgagcggccaatccccgtggaccctgcgtgggcg
cagaaggacaagaagatcagctggctgaacatgcaccctggtggccgtgcgctgctgctt
gcgtacgtgggcaaggacgcgacggccgccttcaacggcggtgtgtatggccacacgacg
ggcgcgcacaactacctgccggagctgcgcgtgggccgcatgaaggagcgccccgcctct
tcggcgtctggcgaggaggggagtgccgctgtttgtacagggcagtgcgttacgctacct
cggcgatgtgacgttcccctgtaa

DBGET integrated database retrieval system