KEGG   Leishmania major: LMJF_15_0180Help
Entry
LMJF_15_0180      CDS       T01014                                 

Definition
putative serine/threonine-protein kinase
Orthology
K08825  
dual specificity tyrosine-phosphorylation-regulated kinase 1 [EC:2.7.12.1]
Organism
lma  Leishmania major
Brite
Enzymes [BR:lma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     LMJF_15_0180
Protein kinases [BR:lma01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   LMJF_15_0180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
15:complement(66234..67799)
Genome map
AA seq 521 aa AA seqDB search
MHARTGFSNGRLPFHSESVASTAAGTTRSPSHPQLPLSHPTASSAAAAAATTSSLSVAAK
EGGTNGAGASTSDGADPYARPAISLSVHLLDLYKMVNARYCAQRRLESPGPKYNSGYDDK
DGHYLFLPGEVIFQRYIAQEVLGKGSFGTVIRGFDQKRSEAVAMKITRRGSSFRSQAKLE
LDILLRLNENPALNHLVVRLLKVFEWQGHLVLVFELLSFNLYQLIKCTRFNGVSLDLVRK
FAYQLTHTLLQLELQKPHPIIHCDLKPENILLRNQNRSGIRLIDFGSACYTAKRFHRYIQ
SRFYRSPEVILFLDYGTPIDRWSLACVLVEMHTGVPLFDGRTEAAQLAKIEATLGPIPAG
MVAGSPKANRFYYGNATSGFQLKEPIPERRTLESVIGVTTGGPRGRRLHTPGHDETAYRE
FHDFVSRFLRYEPEERMNCRDALQHPFLRPLYTSDLQQQKDREIAQPISAPQPPQKQQHT
QCSQNSKPQPQPQPPQSITATTTTTLTSTEHSRASALPPVE
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgcacgccagaacgggttttagtaacggcaggctgccatttcattccgagtcagtcgcg
tccacggcagccggcaccacgcggtcaccgtcgcacccacagctgcccctatcccacccc
accgcgtctagcgctgctgcggcggcagcgactacatcttccttgagtgttgccgcgaag
gagggtggtaccaacggcgcgggcgcgagtacctcggacggggccgatccctacgcacgc
ccagccatctccctcagcgtgcatcttctggacctgtacaagatggtgaacgcgcggtac
tgcgcccagcggcgcctcgagtcgccgggaccgaagtacaacagcggctacgatgacaag
gatggtcactatttgttcctaccaggggaggtgatcttccagcggtacattgcgcaggag
gtactgggcaagggcagtttcggcaccgttatccgcggctttgaccagaagcggtccgag
gctgtggcgatgaagatcacgcgtcgcggctcgagctttcggagccaggcgaagctggag
cttgacatcctgttgcgcctcaacgagaacccagcgctgaaccatctcgtggtgcggctg
ctgaaggtgtttgaatggcagggccaccttgtactggtgtttgaactgctgagcttcaac
ctctaccagctcatcaagtgtacccggttcaatggcgtgagtctggacctagtgcgcaag
ttcgcctaccagctgacgcacacgctgctgcagcttgagttgcagaagccgcacccgata
atccactgcgacctgaagccagagaacatactgctgcgcaatcaaaacagaagcggcatc
cgcctgatcgactttggctccgcctgctacactgccaaacgtttccaccgctacatccaa
agccggttctaccgaagcccagaggtgatactgtttctcgattacggcacgccgatcgat
cgctggtcgctggcgtgcgtgctagtggagatgcacaccggcgtccctctgtttgacggc
cgcacggaggcggcgcagctggcaaagatcgaggccactctcggcccgataccggcggga
atggtggcagggtcgcccaaggcaaatcggttctactacggcaacgccacgtctggattt
cagctgaaggagcccattccggagcggcgcacgctcgagagcgtcatcggcgtcaccacc
ggcgggccgcgcggccggcgtctccacactcccggccacgacgaaacggcgtaccgcgag
ttccacgacttcgtctcacgctttttgcgatatgaaccggaggagcggatgaactgccgc
gatgcactgcagcatcctttcctgaggcccctgtacacttcagaccttcagcaacagaag
gatcgtgaaattgctcagccgatatccgccccgcagcccccacagaaacagcaacacact
caatgctctcagaacagcaagccgcagccgcagccgcagccgccgcagagcattactgcc
acaacgacaacgacgctcacctccacagagcacagccgcgcatctgctcttcctccagtc
gaatag

DBGET integrated database retrieval system