KEGG   Leishmania major: LMJF_15_0270Help
Entry
LMJF_15_0270      CDS       T01014                                 

Definition
(RefSeq) putative replication Factor A 28 kDa subunit
  KO
K10739  
replication factor A2
Organism
lma  Leishmania major
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lma00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    LMJF_15_0270
   03420 Nucleotide excision repair
    LMJF_15_0270
   03430 Mismatch repair
    LMJF_15_0270
   03440 Homologous recombination
    LMJF_15_0270
DNA replication proteins [BR:lma03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    LMJF_15_0270
DNA repair and recombination proteins [BR:lma03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     LMJF_15_0270
   MMR (mismatch exicision repair)
     LMJF_15_0270
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     LMJF_15_0270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
15:105807..106580
Genome map
AA seq 257 aa AA seqDB search
MLASTPGSNFGGAVASSNNNGGQQPQRRMHPIRPLTIKQMLEAQSVGGGVLVVDGREVTQ
ATVVGRVVGYENANMASGGGAITAKHFGYRITDNTGMLVVRQWIDADRMQEPLAINTHVR
ASGTVNVWQQTPIVTGTVVSMADSNEMNYHMLDAILTHFRLTQGNKRAPSSGVSIQNTAS
AVGMHNMLPGGDNKVLLTDLLVSFIKQHGSSGAGMSMDELTTSAQRYGFTHGDVRTAMRT
LAAEGKVYQTHDNRFNI
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcttcgacccccggcagcaacttcggaggcgctgtcgcatcctcgaacaacaat
ggcggccagcagccgcagcgtcgcatgcatccaattcgcccgctcaccatcaagcagatg
ctggaggctcagagcgttggcggcggtgttctggtcgtggacggccgcgaggtgacgcag
gcgaccgttgtaggccgtgtggtgggctacgagaacgccaacatggcctctggtggtggc
gccatcactgccaagcactttgggtaccgaatcaccgacaacacgggcatgctcgtcgtg
cgccagtggatcgatgcggacaggatgcaggagccccttgccattaacacgcacgtccgc
gcgtctggcacagtgaatgtgtggcagcagacccccatcgtcaccggcaccgtggtgagc
atggcggacagcaacgaaatgaactaccacatgttggacgccattctgacgcacttccgc
ctgacacagggcaataagcgtgccccgagcagtggtgtctcgatacagaatacggcctcg
gccgttggcatgcacaatatgctgcctggcggcgacaataaggtgctgctgacagacctc
cttgtctctttcatcaagcagcacggcagcagcggtgctggcatgtcgatggatgaacta
acgacgtcggcgcagcgctacggcttcacccatggcgacgtgcgcaccgcgatgcggacg
ctggcagcggaggggaaagtgtaccagacccacgacaaccgcttcaacatctaa

DBGET integrated database retrieval system