KEGG   Leishmania major: LMJF_16_1320Help
Entry
LMJF_16_1320      CDS       T01014                                 

Definition
putative cytochrome c
Orthology
K08738  
cytochrome c
Organism
lma  Leishmania major
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:lma00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Structure
PDB: 

Jmol
Position
16:complement(535832..536173)
Genome map
AA seq 113 aa AA seqDB search
MPPKARAPLPPGDVERGEKLFKGRAAQCHTATKGGSNGVGPNLFGIVNRPSGKVEGFTYS
KANAESGVIWTPEVLDVYLENPKKFMPGTKMSFAGIKKPQERADVIAYLETLK
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgaaggctcgtgcccctctgccgcctggtgacgtggagcgcggcgagaagctg
ttcaagggccgcgctgctcagtgccacaccgcgaccaagggcggctcgaacggtgtgggc
ccgaacctgttcggcatcgtcaaccgtccctccggcaaggtcgagggcttcacgtacagc
aaggcgaacgccgagtcaggcgtaatctggacgccggaagtgctggacgtgtacctggag
aacccgaagaagtttatgcctggcacgaagatgtcgtttgccggcatcaagaagccgcaa
gagcgcgctgacgtgatcgcgtacctcgagactctcaagtaa

DBGET integrated database retrieval system