KEGG   Leishmania major: LMJF_17_1100Help
Entry
LMJF_17_1100      CDS       T01014                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase-like protein
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
lma  Leishmania major
Brite
Enzymes [BR:lma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     LMJF_17_1100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
17:537743..539374
Genome map
AA seq 543 aa AA seqDB search
MSADARIAIIAVVHLALTWVLLRYIADSAMPFYVYREDSSSAGAAHGASVHTAATHEWDL
WPPFLVPSQEAYVAQLARQQRATSAADAVALNSRVVWRSSAFHLTLAIFTYALLRFGVTA
PYGRHSWSLGFQLTLPSRVSWMLQESPTIFQVLYHAFLEYPRLMGHSPSQPSLWPASSSA
SGPTGAGMPSSHSSADTCHSYWGCVRVACTQQHLGLLLFVIHYVHRSWLYPLSIPATARD
VPLVVTGMATLYCLFNGRLQVLASAGAAATACAADTAARSSACTPAYTASMNLVRCWRER
HALQSLSSPSSASTSVGAAAVRVGWWLLLGLYALGVLGGSALFFLGQRINMQADYYLVRL
RRGDKGSISHGGIKPVGRRAVNVHGDALASSSSSEASRAAQHRSSVDGYRIPVGGWFDSV
SCANFFGELVEWTGYVIVVAATSAASNGSCLSVTTALEEELLRPLSSSSWWSLMNPIMWL
RLVARVFFSGSESRPAALAAFSFLVYVFSNLAPRAVAHHAWYARTFGDLYTRLGRQALIP
GVY
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctgatgcgcgtatcgctatcatcgccgtcgtgcaccttgcgctgacgtgggta
ctgctgcgctacatcgcagattccgccatgcccttctacgtgtaccgcgaagacagcagc
tctgccggtgccgcccacggtgcctctgttcacacggcggcgacgcatgaatgggacctg
tggccgcccttcctcgtgccgagccaggaggcgtacgttgcacagctcgcccgacagcag
cgcgcgacgtcggctgccgatgctgtcgccctcaacagtcgtgtggtgtggcgcagtagc
gcgttccacctcacgctcgccatcttcacctacgcattgctgaggtttggcgtcacggcc
ccgtacggccgccactcctggtccctcggcttccagcttaccctcccctcgcgcgtcagc
tggatgctgcaggagagtcccaccatcttccaggtgctctaccacgcctttctagagtac
ccgcgcctcatggggcacagcccttcacagccatcgctgtggccagcgtcctcctctgcc
tccggcccgactggtgctgggatgcccagcagccattcttcggcggacacatgtcattcc
tactggggctgtgtgcgggtcgcctgcacgcagcagcaccttggactcctgctctttgtt
atccactacgtccaccgcagctggctctatccgctgtcgatccccgccaccgcacgtgat
gtgccgctcgtcgttacggggatggcgaccctgtactgtctcttcaacggtcgcctacag
gtgctggcgagcgcaggtgcggctgccacggcgtgtgcagccgacacggcagcgcggtct
tcggcatgcactcccgcgtacacggcgtcgatgaaccttgtgcggtgttggcgcgagcgc
cacgcgctgcagtctctcagctccccctcctccgcctccacctccgtcggagctgccgct
gttcgcgttggctggtggcttcttttgggcctctacgctcttggcgtcttgggcggctca
gcgctgttcttcctcggacaacggattaacatgcaggcagactactacctggtgcgtctg
cgccgcggtgacaagggcagcatcagccacggtggcatcaagccggtcggacggagggcg
gtgaatgtgcacggggatgcgctggcgtcgtcgtcgtcgtctgaggcgtctcgtgctgct
cagcaccgcagtagcgttgacggctatcgcatccccgtcggcggttggttcgactccgtc
agctgcgcgaacttctttggcgagcttgtcgagtggacgggctacgtcatcgtcgtcgcg
gcgacgtctgctgctagcaacggcagctgcctctccgtgacgactgccctcgaggaggaa
ttactgcgaccgctctcgtcgtcgtcttggtggtcactgatgaacccgatcatgtggctg
cgcctcgttgcgcgcgtgttcttcagcgggtcggagtcacgcccggcagctctggcggcg
tttagcttcctggtgtacgtcttcagcaacttggccccgcgtgcggtggcgcatcatgcg
tggtacgccaggacgttcggtgacctttacacgaggctcggccgccaggcgctcataccc
ggtgtgtactag

DBGET integrated database retrieval system