KEGG   Leishmania major: LMJF_17_1220Help
Entry
LMJF_17_1220      CDS       T01014                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
lma  Leishmania major
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
17:593304..593639
Genome map
AA seq 111 aa AA seqDB search
MATHRRPSSKPPHSHKSHRKPKRSWNTYVGRSLKAINAQMSMSHHTMKIVNSYVNDVMER
ICTEAALIVRANKKSTLGAREVQTAVRIVLPVELAKHAMAEGTKAVSKMSR
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggccacccaccgccgcccttccagcaagcctccccactcgcacaagtcacaccgcaag
ccgaagcgctcgtggaacacgtacgtgggccgctcgctgaaggcgatcaacgcccagatg
tcgatgtcgcaccacacaatgaagatcgtgaactcgtacgtgaacgacgtgatggagcgc
atctgcaccgaggccgcgttgattgttcgcgcgaacaagaagtccacgttgggtgcgcgc
gaggtgcagacggcggtgcgcattgtgctgccggtggagctcgcgaagcacgccatggcc
gagggcacgaaggccgtgtcgaaaatgagccgttag

DBGET integrated database retrieval system