KEGG   Leishmania major: LMJF_18_0990Help
Entry
LMJF_18_0990      CDS       T01014                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lma  Leishmania major
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lma00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LMJF_18_0990
   00052 Galactose metabolism
    LMJF_18_0990
   00500 Starch and sucrose metabolism
    LMJF_18_0990
   00520 Amino sugar and nucleotide sugar metabolism
    LMJF_18_0990
Enzymes [BR:lma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LMJF_18_0990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Structure
PDB: 

Jmol
Position
18:412668..414152
Genome map
AA seq 494 aa AA seqDB search
MENDMKSLSAAAQACVKKMRDAKVNEACIRTFIAQHVMVSKGETGSIPDSAIMPVDSLDA
LDSLTIECDNAVLQSTVVLKLNGGLGTGMGLCDAKTLLEVKDGKTFLDFTALQVQYLRQH
CSEHLRFMLMDSFNTSASTKSFLKARYPWLYQVFDSEVELMQNQVPKILQDTLEPAAWAE
NPAYEWAPPGHGDIYTALYGSGKLQELVEQGYRYMFVSNGDNLGATIDKRVLAYMEKEKI
DFLMEVCRRTESDKKGGHLARQTVYVKGKDGQPDAEKRVLLLRESAQCPKADMESFQDIN
KYSFFNTNNLWIRLPVLLETMQEHGGTLPLPVIRNEKTVDSSNSASPKVYQLETAMGAAI
AMFESASAIVVPRSRFAPVKTCADLLALRSDAYVVTDDFRLVLDDRCHGHPPVVDLDSAH
YKMMNGFEKLVQHGVPSLVECKRVTVKGLVQFGAGNVLTGTVTIENTDSASAFVIPDGAK
LNDTTASPQQSTNK
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacgacatgaagtccctcagcgccgccgctcaggcgtgcgtaaagaagatgcgc
gacgccaaggtgaacgaggcatgcattcgcaccttcatcgcacagcacgtcatggtcagt
aaaggcgagacagggtccattcccgactccgccatcatgccggtcgactccctcgatgcc
ctggacagcctcaccattgagtgcgacaacgctgtcctgcagagtaccgttgtgctgaag
ctgaacggcggcctcggcaccggcatggggctgtgcgacgccaagacgctgctcgaggtc
aaggatggcaagacgtttcttgactttacagcgcttcaggtacagtaccttcgccagcac
tgcagcgagcacctgcgctttatgttgatggacagcttcaacacctccgctagcaccaag
agctttctgaaggcgcgctacccgtggctgtaccaggtctttgactcagaggtggagctg
atgcagaatcaggtgcccaaaatactgcaggacacgctcgagccggcggcctgggccgag
aacccggcgtacgagtgggcgccgccggggcacggtgacatctacaccgctctgtatggc
tccggcaagctacaggaactcgtcgagcagggctaccgctacatgttcgtcagcaacggg
gacaacctcggcgccaccatcgacaagcgcgtgctggcgtacatggagaaagagaagatc
gactttctgatggaggtgtgccgccgaacggagagcgacaagaaaggcggtcacctggct
cggcagacggtgtatgtgaagggcaaggacggtcaaccagacgccgagaagagggtgctg
ctgctgcgggagtccgcccagtgccccaaggcggacatggaaagcttccaggacatcaac
aagtactccttcttcaacacgaacaacctatggatcaggctcccggtgctcctggagacg
atgcaggagcacggcggcacgctgccgctgccggtcatccgaaacgagaagacggtcgat
tcatctaattcagcatcacccaaggtgtatcaactggaaactgccatgggtgccgcgatc
gccatgttcgaaagcgcatcggccattgtcgtgccgcgcagccgcttcgcgccagtgaag
acgtgcgccgatctgctcgctctgcgctccgacgcctacgtcgtgacggacgacttccgg
ctcgtcctggacgatcgctgccacggccacccgcctgtcgttgacctcgacagcgcgcac
tacaagatgatgaatggctttgagaagctcgtgcaacacggcgtgccatcgctggtggaa
tgcaaacgcgtgacggtgaaggggctggttcagttcggtgctggcaacgtgctcacaggc
acggtcacgatcgagaacacggacagcgcctcggcgtttgtgatccccgatggtgccaag
ctgaacgacacaacggcgtcaccgcagcagtcgaccaacaagtag

DBGET integrated database retrieval system