KEGG   Leishmania major: LMJF_18_1030Help
Entry
LMJF_18_1030      CDS       T01014                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
lma  Leishmania major
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LMJF_18_1030
Enzymes [BR:lma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     LMJF_18_1030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
18:429853..432186
Genome map
AA seq 777 aa AA seqDB search
MSAMICSLLVLGWIAADDSNVFVDDFTAGDAWLNPNSNQKKWQKALLQSAKLNLPVPNSV
AMNQVFFVSCNRHDRSQLYWAYMAVAAQCEMLSWKNATAAPPCRRLYAGVSPLLRTAGTA
ASSGGPHGHTTDTDEGNWQEEVPLGACGSVYDSPAAAEQRQRYRRTSPPLLLLDETPPPL
HRDADPGQCFRAAPRDTVYSTGVPLDALIWLGDIIYADKFPDGRDAQSLLFHHVNTMVSI
GRFWRIQRDAPEYNAFIGSCVAGSDHPYWTLHSPGEVFLPAAAGNRERIMQLTPSPSSGT
HRNVWATWDDHDMGENDGGREYTGRNSTQRFFLSFLRAPSSDPRWGREGVYGAYTTDFRD
VVDDAKGWGTPMRLLMQQLYEHAICVVLLDVRSFRDRPNATQAGDMLGAEQWAWFEELLQ
NYTTLTRDGRERCAMVLIGGGIQFILDEKPAENWAAFPRSRDRLLGLLHAYRVERVAFIT
GDVHMGELGADFTKHGIEEVLGYPIVEATSSGLTHSANMYFLPTFMPLLFPSPRRLGLYV
GTNFGALRLSLDLRHLPLIRSYLIEMEATVAAARFQTPQWRRKVRTAVEQVVNATFTIFS
IPKGGQPVYRLNFPLSMLTYAHGVAYRDATVDAVNGNVHKKPTSSPVTPEKNGGSKAAKD
DTERTPSSPLRALLVLKNGTIMDIAHYRNTEPAPLITQSARQLQYYISTNFSVSETLKLI
ILLELSVWALVLLLLMTTLCRCLRRPRNSCGRFHSSHVASSPQVSLVTRCSKKRVNN
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctatgatatgttccctgctcgtcctgggctggatcgcagctgatgactctaat
gttttcgttgacgacttcacggcaggcgacgcttggttgaaccccaatagcaaccaaaag
aagtggcagaaagcactactccagtctgcgaaactcaacctccccgtccctaacagtgta
gccatgaatcaagtcttcttcgtcagctgcaatcggcatgatcgcagtcagctctattgg
gcctacatggcagtcgcagcacagtgtgagatgctgtcctggaagaatgccacggcggcg
ccgccttgtcggaggctctacgccggcgtgtccccgctgctacgcaccgccggtaccgcc
gcctcttcaggggggccgcacggacacacaacagatacggatgaaggaaactggcaggag
gaggttcctctcggagcatgtggctccgtgtacgactctcccgcggcagcggagcagcgt
cagcgataccggcgaacctcgccgccgctgctgctgctggatgagactccacccccgctt
caccgcgacgccgaccctgggcagtgctttcgtgctgcaccacgtgacaccgtctactcc
actggcgttccgctggacgccttgatctggctaggggacatcatctacgccgacaagttc
ccggacggcagggacgcgcagtcgctcctgttccaccacgtcaatacaatggtaagcata
gggcgattctggcgaatccagcgtgacgccccggagtacaacgccttcattggcagctgc
gtcgcaggtagcgaccatccatactggacgctgcactcacctggggaagtgtttctgccc
gcggctgcgggcaatcgtgagcgaataatgcaactgaccccctcgccctcctccggcact
caccgcaacgtgtgggccacctgggatgaccacgacatgggcgagaacgatggtggacga
gagtacaccggccgtaacagcacgcagcgcttctttctgagctttttgcgagccccctca
agtgacccacgctggggtcgtgagggcgtgtatggtgcatacacaacggactttcgcgac
gtcgtggacgacgccaaggggtggggaactccgatgcggctcctgatgcagcagctttat
gaacatgccatctgcgttgtcctcctcgacgttcgctcgttccgtgaccgcccgaacgcg
acccaggccggcgacatgctcggcgctgagcagtgggcgtggtttgaggagctcctgcag
aactacacgacactgacgcgagacgggcgggagcggtgtgctatggtgctcatagggggc
ggcattcagttcatcctggatgagaagcccgcggagaactgggcagccttcccccgctct
cgggatcgcctcctcggactactgcacgcctaccgagtcgagcgcgtggccttcatcacc
ggcgatgtgcacatgggtgagctgggcgccgacttcaccaagcacggcattgaggaggtg
ctggggtacccaatagtggaggccacgagctcggggttgacacacagtgcgaacatgtac
tttctccccacatttatgccactgcttttccccagtccacggcgtctcggcctctatgtg
gggacgaactttggtgcgttgaggctctccctggacctgcgtcacctgcctttgattcgc
tcatacctgatagagatggaggcgacggtggcggcggcacgctttcagacaccacagtgg
cgccgcaaagtccgcactgccgttgagcaagtcgttaatgctaccttcaccatcttctcc
atcccaaaaggcggccaaccagtgtaccggctgaactttcctctctctatgctcacctac
gcgcacggtgtagcgtaccgcgacgccacagtagatgcggtgaatgggaatgtgcacaag
aagccaacgtcatccccagtgacgccggaaaagaacggcggcagcaaggcagcgaaggac
gacacggaacgcacaccatcgtcgccgctgagggcgcttctcgtacttaagaacggtacc
attatggacatcgcccactaccgcaacaccgagcccgcaccgctcattacgcagtcggcg
cgccagctgcagtactacatctccaccaacttctccgtctccgagacgctgaagctgatc
atcctgctcgagttgtcggtctgggctttggtgctcttgctgctgatgaccacgctatgt
cggtgcctgcggcggccacgaaacagctgcggcagattccattcctcccacgtagcatcc
tcgcctcaagtgtccctcgtgacgcggtgttcgaagaagagggtgaataactag

DBGET integrated database retrieval system