KEGG   Leishmania major: LMJF_18_1080Help
Entry
LMJF_18_1080      CDS       T01014                                 

Gene name
PKAC1
Definition
protein kinase A catalytic subunit
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
lma  Leishmania major
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
18:456651..457649
Genome map
AA seq 332 aa AA seqDB search
MITKAEASQWRLSDLEMRETVGTGTFGRVRLVKHKGTGQYAALKILKKQEILRMKQVDHV
MAEASLLQEIDHPFIVSMLRGYMDKNRLYILLEYVVGGELFSHLRKAGKFPNDVSKFYCA
EVILAFDYLHNKTIVYRDLKPENILLDQDGNIKITDFGFAKRVTERTFTLCGTPEYLAPE
IIQSKGHNKAVDWWALGILLYEMLVGYPPFFDDSPMKIYEKILVGKVLFPRWVDSKARDF
IKGLLSLDPTKRLGNLPNGTEDIKNHKYFAEVDWNVVLSKKIPAPIPVRQHKEGDTHYFD
KYPDSPLNPLRTLTPAQQDCFANFCNGQYTDE
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccaaggccgaagcttcccaatggaggctgagcgacttggagatgcgtgagacg
gtcggcaccggcactttcggccgagtacgcttggtgaagcacaaaggaacaggccagtac
gcggccctcaagatcctgaagaagcaggagattctccgaatgaagcaggtcgaccacgtg
atggcggaggcaagtcttctccaggagatcgaccacccttttattgtgagcatgctgcgg
ggatacatggacaagaaccggctgtacattctcctcgagtacgtggtaggcggcgagctg
ttttcgcatctccgcaaggccggcaagttccctaatgatgtctcgaagttctactgcgcc
gaggtgatcctagcatttgactacctgcacaacaagacgatcgtttaccgtgatctgaag
ccggagaacattctcctcgaccaggacggcaacataaagatcacggatttcggattcgcg
aagcgcgtgacggagcgtacgtttacgctttgtggcacacccgagtacctagcacccgag
atcattcagagcaaggggcacaacaaggctgtcgactggtgggcgctcggcatcctgctg
tacgaaatgctggttggctatccgccgttcttcgacgacagcccaatgaagatctacgag
aagatccttgtgggcaaggtgctgttcccacgatgggtagactcgaaggcccgagacttc
atcaagggccttctatccctcgatcccacgaagcgcctcggcaatttgcccaacggcacg
gaggacatcaagaaccacaagtactttgcggaagtggactggaatgtagtgctgtccaag
aagattcccgcgccaatcccagtgcggcaacacaaggagggcgatacccactacttcgac
aagtaccccgacagcccactcaaccctttgcgcactttgactccagcacagcaggactgc
ttcgccaacttctgcaacggccagtatacggacgagtag

DBGET integrated database retrieval system