KEGG   Leishmania major: LMJF_19_0030Help
Entry
LMJF_19_0030      CDS       T01014                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
lma  Leishmania major
Brite
Exosome [BR:lma04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LMJF_19_0030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
19:complement(5559..5882)
Genome map
AA seq 107 aa AA seqDB search
MASSRKASNPHKSHRKPKRSWNVYVGRSLKAINAQMSMSHRTMKIVNSYVNDVMERICTE
AASIVRANKKRTLGAREVQTAVRIVLPAELAKHAMAEGTKAVSSASR
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttcccgcaaggcttccaacccgcacaagtcgcaccgcaagccgaagcgctcg
tggaacgtgtacgtgggccgctcgctgaaggcgatcaacgcccagatgtcgatgtcgcac
cgcacgatgaagatcgtgaactcgtacgtgaacgacgtgatggagcgcatctgcactgag
gccgcgtcgattgttcgcgcgaacaagaagcgcacgttgggtgcgcgcgaggtgcagacg
gcggtgcgcattgtgctgccggcggagctcgcgaagcatgccatggctgagggcacgaag
gccgtgtcgagcgcgtcccgctaa

DBGET integrated database retrieval system