KEGG   Leishmania major: LMJF_19_1440Help
Entry
LMJF_19_1440      CDS       T01014                                 

Gene name
MPK4
Definition
putative mitogen activated protein kinase 4
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
lma  Leishmania major
Pathway
Leishmaniasis
Brite
KEGG Orthology (KO) [BR:lma00001]
 Human Diseases
  Infectious diseases
   05140 Leishmaniasis
    LMJF_19_1440 (MPK4)
Enzymes [BR:lma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     LMJF_19_1440 (MPK4)
Protein kinases [BR:lma01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   LMJF_19_1440 (MPK4)
Exosome [BR:lma04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LMJF_19_1440 (MPK4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
19:632989..634080
Genome map
AA seq 363 aa AA seqDB search
MAQLVPLAELPSGKKIYSVRGQRFEVDREYDLVKVVGFGACGTVCSAVANGSGERVAIKR
LSRVFGDLREGKRILREMEIMTSLKHNNLIRLHHFMRPQSKETFEDIYLVMDLYDTDLNR
IIRSRQKLTDEHLQYFMIQAFRGLHYLHSAKVMHRDLKPSNLLVNADCALAICDFGLARD
DQVMSSSDLTQYVVTRWYRPPEVLGMGSNQYTSAVDVWSLGLIFAELMVGRALLPGTDYI
GQLVMIVNLLGSPSIDDMEFLSSEAKAFILSQPHRPALSFRDLFSMATEEATDLLSKLLV
FHPARRLTAKQVMEHPYFSKYRDAAEEADAPDPFVWNHSHIETKEQLREDLWRVVEAHSQ
LNE
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggctcaactcgtccctttagctgaactgcccagcggcaaaaaaatatatagtgtccgg
gggcagcgtttcgaagtggacagggaatatgatctggtcaaggttgttggatttggtgcg
tgtggcactgtttgttcagcggtcgcgaacgggtcgggtgagcgagtggcgatcaagcgg
ttgtcgcgtgtttttggtgatcttcgtgaagggaaacgaattttgcgggagatggagata
atgacgtcgctgaagcacaataatctgattcgcctccaccacttcatgcggccgcagtca
aaggagacgtttgaggacatttacttggtgatggatctttatgacacagatttaaatcgt
attatacgaagtcggcagaaactcactgatgagcatctgcagtattttatgattcaagcg
ttccgcggattgcattaccttcactctgccaaggtgatgcatcgcgatctgaagccgagc
aacttgcttgtaaatgcggactgcgcgctagcaatctgcgattttgggctggctcgtgat
gatcaagtcatgagctcgtcagatctcacacagtacgtcgtaacacggtggtacagaccc
cctgaggtactcgggatgggatccaatcagtacacgagcgcggtagatgtctggagcctt
ggtctgatctttgcggagctaatggtggggcgtgccttgcttccgggaacagattatatt
ggacagctagtgatgattgtcaacctattagggtccccgtccatagatgacatggagttt
ctgagctcagaagcaaaggcgtttattctctctcagccgcatcggccggctctctccttc
agagatcttttttcaatggctacagaagaggccactgaccttctgtcgaagctgctagtt
ttccatccagcgagacgattaactgcgaagcaagtgatggaacatccatatttttcgaag
tacagagatgccgcagaagaagctgacgctcctgatccgtttgtgtggaatcatagccat
atagaaaccaaggagcaactccgtgaggatttgtggcgggttgttgaagcccattcacaa
ttgaacgaatag

DBGET integrated database retrieval system