KEGG   Leishmania major: LMJF_20_0970Help
Entry
LMJF_20_0970      CDS       T01014                                 

Definition
putative 1,2-Dihydroxy-3-keto-5-methylthiopentene dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
lma  Leishmania major
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:lma00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
20:403948..404982
Genome map
AA seq 344 aa AA seqDB search
MTDCWYIPEAVADRRDENRLSPNVPASYEVLGEAGIFYRHFDSEEVNDNIEGFIQPLLKK
LNYQSYDVVNLSPANLGAEKFETLAEQHFMEHIHEDDEVRLILEGQGYFDVRDINDKWIR
LLLKPGDCIVVPAGMYHRFTTDQSKCIKTLRIFKEAPQWIALNRGPEAEEKPARKEYLAR
LHAPAETAVGAVNGRTIFSLRYPLKLDAELTVITKRLLEQHSKQPLALAIYLTGSTDPTT
GESWCPDCVLAKLHVARRFAELQGTYGKEHAIFLQLPVERASYLGNPNFFYRTHPILQLA
SVPTLLVLSPAKDAKEGGDVQWYDLLDVKVRTCDVDRTDVLNLE
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaccgactgctggtacataccagaggcggtggcggatcgccgcgatgagaaccgactt
tcgccaaacgtgcccgccagctacgaggtgcttggtgaagcagggatcttctaccgtcac
ttcgactcggaggaggtaaacgacaacatcgagggcttcatccagccgcttctcaagaag
ctcaactaccagagctacgatgtcgtgaacctcagcccggcgaacctcggagcagagaag
tttgagactctggcggagcagcacttcatggagcacattcacgaagacgatgaggtgcgg
ttgattctcgaaggtcagggctactttgacgtgcgcgatatcaacgacaagtggattcga
ttgctgttgaagcctggcgactgcatcgttgtaccggcgggcatgtaccaccgcttcacg
acggatcagagcaagtgcatcaagacgctgcgcatcttcaaggaggctccgcagtggatc
gcgctgaaccgcggcccggaggcggaggagaagccggcgcgcaaggaatacctcgcccgc
ctgcacgcccctgccgaaacagctgtcggtgccgtcaacggccgcacgatcttctctctg
cgctacccgctgaagctggatgcggagctcaccgtcattacgaagcggctgctggagcag
cacagcaagcaaccgcttgccctcgcgatttatctgaccggttccacggacccaaccacc
ggcgagtcctggtgtccggactgcgttctggcgaagctgcacgtcgcgaggcgatttgca
gagctccaaggtacgtacggtaaggagcacgccatcttcctgcagctcccggtcgagcgc
gccagctacctaggcaacccgaatttcttctatcgcacgcacccaatcctgcagctggct
agtgtgccgacgctgctcgtgctgtcgccggccaaggacgccaaggagggaggcgacgtg
cagtggtacgacctgctcgacgtcaaggtgcgcacctgcgatgttgacaggacagacgtg
ctgaaccttgagtaa

DBGET integrated database retrieval system