KEGG   Leishmania major: LMJF_21_0680Help
Entry
LMJF_21_0680      CDS       T01014                                 

Definition
putative histone deacetylase
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
lma  Leishmania major
Brite
Enzymes [BR:lma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     LMJF_21_0680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
21:complement(209387..210673)
Genome map
AA seq 428 aa AA seqDB search
MHAVPKDDAEAPLSNTESRGRVALIDTSGYASDMNISAFVPQHAMKPYRVLAAMEIVRSL
KIDAHCRTVVPPLVKVEELMAYHTDTYLANLGLHSCRSWLWNAETSKVFFSGDCPPVEGL
MEHSIATASGTLMGAVLLNSGQVDVAVHWGGGMHHSKCGECSGFCYVNDIVLGILELLKC
HDRVLYVDIDMHHGDGVDEAFCTSDRVFTLSLHKFGESFFPGTGHPRDVGYGRGRYYSMN
LAVWDGITDFYYLGIFEHALHSIVRRYSPDAIVLQCGADSLAGDRLGLLNLSSFGHGQCV
QAVRDLGIPMLALGGGGYTIRNVAKLWAYETSILTGHPLPPNTVLPVAEMPLSGWLFQDS
PLLIVAQDRSNHVLPGLHCQRAYQMMTEQIDRHVPHIQPHPRLQKAFTAAEAADKQVEDG
TTAVEDFK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcggtgcccaaggatgatgccgaggcaccgctttcgaataccgaaagccgcggc
cgcgtggcgttgattgacacctccggctacgcctccgacatgaacatctccgcctttgtg
ccccagcacgcaatgaagccgtatcgtgtgcttgcggcaatggagattgtgcgcagcctc
aagattgatgctcactgccgcactgtcgtgccgcctctagtgaaggttgaggagctgatg
gcataccataccgacacctacctcgcgaacctaggcctgcacagctgccgcagctggctg
tggaatgcggagacctcgaaagttttcttctctggagactgtcccccggtcgaggggctg
atggagcactccatcgctacagccagtgggacgctgatgggagcggtactactcaacagc
ggccaggtcgatgtggcggtgcactggggtggtggaatgcatcactcgaagtgtggcgag
tgctccgggttctgttacgtgaatgacatcgtgctcggtattctcgagcttctgaagtgc
catgaccgggtgctgtacgtcgacattgatatgcaccacggcgacggtgtggatgaggct
ttctgcacgagcgatcgcgtcttcacactctcactgcacaagttcggtgagagcttcttc
cctggcacggggcacccgcgcgacgtcggctacggtcgtggacgctactacagcatgaat
ctggctgtatgggacggcatcaccgacttctactaccttggcatatttgaacatgcgctg
cactccattgtgcggcgctactcaccagatgcaattgtgctccagtgcggcgccgactcg
ctcgccggcgatcgcctcggcttgcttaacttgtcgtccttcggtcatgggcagtgcgtg
caggcggtgcgtgatctcggtattccgatgctggcgctcggtggcggcggctacacgatc
cgcaacgtcgcaaagctgtgggcgtatgagaccagtatcttgactggtcacccactgccg
ccgaacacggtgctcccggttgctgagatgccgctgagcgggtggctctttcaggactcg
ccgctgctgattgtcgcgcaggaccgcagcaatcacgttttaccagggcttcactgccag
cgtgcgtaccagatgatgacggagcaaatcgaccgccacgtgccgcacattcaaccgcat
ccacggctgcaaaaggcgttcaccgcagcagaagcagcggacaagcaggtggaggacggc
acgacagccgtcgaggatttcaagtga

DBGET integrated database retrieval system