KEGG   Leishmania major: LMJF_21_1630Help
Entry
LMJF_21_1630      CDS       T01014                                 

Definition
putative calcineurin B subunit
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
lma  Leishmania major
Brite
Protein phosphatases and associated proteins [BR:lma01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     LMJF_21_1630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
21:complement(708606..709133)
Genome map
AA seq 175 aa AA seqDB search
MNEIPLTAEELQNIRESTALTDAQVQRLYKSFSKLNKDKSGKITRAEFNSIPALASNPLV
DRVLAVMDTDGDSTVDFGDFVRALAVLSSATSKEDKLRFTFKMYDVDGDGRISNKDLFQM
LSIMVGVNLSQMQLQQIVDKTFIEADVDRDGYITFEEFQALAVNSDFGDRLNLHF
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagattccactcacagcggaggagctgcagaacatccgcgagtccacggcgctc
acggacgcgcaagtgcagcggctgtacaagagcttttccaagctgaacaaggacaagtct
ggcaagatcactcgggcggagttcaactcgatccctgcactagcctccaacccactcgtc
gacagagtgctggcggtgatggacacggacggcgactccacagtagactttggggacttt
gtgcgggcactggcggtgctctcctcggcgacctcgaaggaggataagttgcggttcacg
ttcaagatgtacgacgtcgacggtgatggccgcataagcaacaaggacctctttcaaatg
ctcagcatcatggttggggtgaacctctcccagatgcagctgcagcagattgtggacaag
acattcatcgaagcggacgttgatcgggacggctacattacgtttgaggagtttcaggcg
ctggccgtaaacagcgactttggcgatcggctgaacctgcatttttag

DBGET integrated database retrieval system