KEGG   Leishmania major: LMJF_22_0770Help
Entry
LMJF_22_0770      CDS       T01014                                 

Definition
putative NADH-cytochrome b5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
lma  Leishmania major
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lma00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LMJF_22_0770
Enzymes [BR:lma01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     LMJF_22_0770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
22:complement(315686..316555)
Genome map
AA seq 289 aa AA seqDB search
MKAFIASVVGFAGASMYQSGSEVEAWGSRPAFSQEKFQPYKLIHVENESHNTKRFRFALA
SSKTRLDLPVASCITLRYTDAQGHEVMCPYTPINLVEEEGHFDLVVKCYPNSKMGSHLFS
LKVGDSIDVKGPWHTFDVKPGQYTSIGMIAGGTGLTPMFQIATNVLNAPENKTMISLLYA
NKTEGDILLGKELDTLAKEHPGKFATYHCLTTPPKRWTGYSGHINKVIIQETMPGSDHQG
DSCVLVSGPPSFMKTICGEKDYSSYPPKQGPLEGYLKELGYSSSGVFKF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcttttatcgcttcggttgtcggctttgctggagccagcatgtaccagtctggg
tccgaggtggaggcctggggcagcaggccggcattctcacaagagaagttccagccctac
aagctcatccacgtcgagaatgaatcgcacaacacaaagcgctttcgctttgcgctcgct
tcgagcaagacgcgcctggacctgcccgtggcgtcttgcatcacgctgcgctacactgac
gcccagggacacgaagtgatgtgcccctacacgcccatcaacctggtggaggaagagggc
cacttcgacctcgtagtgaagtgctacccgaattcaaagatgggctcgcaccttttctct
ctcaaggtcggcgattccattgacgtgaagggaccgtggcacacattcgacgtgaagccg
ggccagtacaccagtattggcatgatcgctggtggtacgggtctcacccccatgttccaa
atcgcgacaaacgtcctgaacgcgccggaaaataagacgatgatttcgcttctgtacgca
aacaagaccgagggggacattctgctcggcaaggagctggacacactggcgaaagagcac
cccgggaagtttgccacgtaccactgcctcacgacgcctccgaagcgctggacgggctac
tctggccacatcaacaaagtgatcatccaggagacgatgccaggctcggatcaccaaggt
gactcgtgcgttctggtgagcggcccaccgtccttcatgaagaccatctgtggcgagaag
gattacagctcctacccgcccaagcaaggcccgctcgagggctacctcaaggagttgggc
tactcatcaagcggcgtcttcaagttctaa

DBGET integrated database retrieval system