KEGG   Leishmania major: LMJF_22_1680Help
Entry
LMJF_22_1680      CDS       T01014                                 

Definition
putative phosphoinositide-specific phospholipase C
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
lma  Leishmania major
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:lma00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    LMJF_22_1680
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    LMJF_22_1680
Enzymes [BR:lma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     LMJF_22_1680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
22:join(687755..688471,688474..689424)
Genome map
AA seq 555 aa AA seqDB search
MLHCSREEVGELLIDSCKRSVGTSVELDTLLSNKNTSKVAPDATAATIMQVRMMYGKDDS
GDLSYAEMTRLVEGLSSSKDLTERILKPFEDDNRHTIAFSEFAKVYSNAVSFKELGYVFQ
DLAGGQQTISRDTFASFVCDIQDEDWDAETLNEKLALMGCVGIDGITENNFVGYIMSPYF
DFAMEKKLTGVYQDMDQIMCCYFISSSHNTYLTGDQLTSKSSAQMYKKGASRRVPVREAI
CRNGPHGEPIVCHGYTRTSCIAFEECVKMIRQYAFTASAYLVILSLGVHTSVEQQDKMAE
ILEEGLGSLLFWPPWGSNEKPTMAFSPNNLKNKILVKAKRGDFPAREPRVDKDDDATETD
SMASTNNADYLKMKEARRKAGKDEVRVSAKLSAIVSIESSKYQGVKDLSYLKDKQPHHCS
SYSERKGKAIVREAHNALVCINDTCLSRVFPAGSRIDSSNYRPLLYWVSGCQMVAINWQS
SDTFGWRLNGCIFLDSGCCGYLLKPDYLRPVTCPDVAVPEYLRSLTVEVIWGFALPSAKQ
ARGCRPVCDSFPRGP
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgctgcactgcagcagggaagaggtgggcgaacttctaatcgattcttgcaaacgcagc
gtgggcacaagcgtcgagctcgacacgctcctgtcgaacaaaaacacatcaaaggtggcg
ccagatgctacggctgccacgatcatgcaggtgaggatgatgtacggcaaggacgatagc
ggcgatttgagctacgccgagatgacgcgtctggtcgaggggctcagctcttcgaaggac
ttgacagaacgaatcttgaagcccttcgaggacgacaatcgccacaccatcgccttttcc
gagtttgcgaaggtgtactcgaacgccgtgagtttcaaggagctcggctacgtcttccag
gatttggcaggtggtcagcagaccatctctcgagacaccttcgccagctttgtctgcgac
atccaagatgaggactgggatgccgagactctcaacgagaagctcgctcttatgggctgc
gtcggcatcgacggcatcaccgagaacaacttcgtcgggtacattatgagtccctacttc
gacttcgcgatggagaagaagctgacgggcgtctaccaggacatggaccagatcatgtgc
tgctacttcatcagctcctcacacaacacgtacctcaccggggaccagctcacgagcaaa
tcctccgcccagatgtacaaaaaaggtgcttctcgacgggtgccggtgcgcgaagctatt
tgccggaacggccctcacggcgagccgattgtgtgccacggctacacccgcacttcctgt
atagccttcgaagagtgcgttaagatgattcgtcagtacgccttcaccgcttccgcatac
ctcgtgatactctcgctgggggttcacacttcggtggagcagcaggataagatggcggag
attctagaagaagggctgggctcgctgctcttctggcctccgtggggctccaacgagaag
cccaccatggccttttcgcccaacaacttgaagaacaaaatcctcgtgaaagccaagcgc
ggcgacttcccagcccgcgagcctcgcgtcgacaaagacgacgatgcaaccgagacggac
tcgatggccagcacaaacaacgccgactacctgaaaatgaaggaggctcgcaggaaggcc
gggaaggacgaggtccgggtgtcagcgaagctgtctgccatcgtctccatcgagtccagc
aagtaccagggcgtcaaggacttatcatacctgaaggacaagcagccgcaccactgctct
tcgtactcagagaggaaggggaaggccatcgtccgcgaggcccacaacgcgctggtgtgc
atcaacgacacgtgccttagccgcgtcttccctgctggctcgcgcatcgacagcagcaac
tacaggccgctgctttactgggtgtctggatgccagatggtggccatcaattggcagtcc
agcgataccttcggctggcgcctcaacggctgcattttcctcgacagcggctgctgcggg
tacctcctgaagccagactatctgcggcccgtgacctgccccgatgtggctgtcccggag
tacttgcggtcgctgacagtggaagtgatttggggcttcgcgctgccgagcgcgaagcaa
gccagaggttgccgacccgtttgtgacagttttcctcgagggccctga

DBGET integrated database retrieval system