KEGG   Leishmania major: LMJF_23_0710Help
Entry
LMJF_23_0710      CDS       T01014                                 

Definition
putative acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
lma  Leishmania major
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LMJF_23_0710
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMJF_23_0710
   00620 Pyruvate metabolism
    LMJF_23_0710
   00640 Propanoate metabolism
    LMJF_23_0710
Enzymes [BR:lma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     LMJF_23_0710
Lipid biosynthesis proteins [BR:lma01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   LMJF_23_0710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
23:complement(334627..336714)
Genome map
AA seq 695 aa AA seqDB search
MSSQVVSSPVTLKSPLSVSQHVGEFNSVRDTNVVEPTEANRTKSHVGPHLGSRMRIYEYS
IEHNDVFWAEIARRDFYWKTTWPDDQHVKSYNFDKSKGPIFVKWFEGAVTNICYNALDRH
LPAHKDRVCFYFEGNDPSVTEKVTYGSMYTRVVELANVLKHQYGITKGDRVGLYLPMIPF
AAVAMLACARIGAVASVIFGGFSAQAIVTRVTDCSPKLIITADASSRGDKPILLKTIADQ
ALDDCSVLGCNVPCLVFENMNRQFCKMKEGRDTWYGDALARLTPEQHEECPVEWMDAEDV
LFLLYTSGSTGKPKAIVHTTAGYMVYASTTFMYSFDYHMDDVYFCTADIGWITGHSYVVY
GPMIHCATSVLFEGVPNYPDYSRWWQLVEKYKVSILYTAPTAIRSLMQAGDDYVKVGNRS
TLRVLGSVGEPINVEAWKWLRDVGGEGHCDVSDTWWQTETGGHMITPMPGCTPMKPGSAT
LPFFGVQPVILDPMKLNEKQGPAEGLLAIRAPWPGMARTIYGDHARFEKTYFDVDGYYMT
GDGARRDSDGYYWITGRVDDVLNVSGHRIGTSEIEDAVNTHPAVVESAVVGFPQSIKGEG
IYVFLTFHQGTEVTPELLAAVKATVRKVIGPLATPDVLHPTQEGLPKTRSGKIVRRILRK
IATHNDDDLGDTSTLADPTVVEALKRSRAKWVDKK
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccaggtcgtctccagtccggtgactctgaagagtccgctgtcagtctcccag
catgtaggcgagtttaacagtgtgcgggacacgaacgttgtggagccgacggaggcaaac
cggacaaagtcgcacgtcggcccccaccttggctcccgcatgcgcatctacgagtactcc
atcgagcacaatgacgtcttctgggccgaaattgcacggcgcgacttctactggaagacg
acctggccggatgaccagcacgtcaagtcgtacaacttcgacaaatccaagggccccatc
tttgtgaaatggttcgagggcgccgtgacaaacatctgctacaacgcgttggaccgccac
ctgccggcgcacaaggatcgcgtgtgcttttactttgaaggcaacgacccgagtgtgacg
gaaaaggtcacgtacggcagcatgtacacgagggtggtggagctggcgaacgtgctgaag
caccagtacggtattacaaagggcgaccgcgttggcctgtatctacccatgatcccgttc
gctgcagtggccatgctcgcctgcgcccgcatcggtgcggtggccagtgtcatctttggc
ggattttcggctcaggcgatcgtgactcgtgtcacggactgcagcccgaagctcatcatc
actgctgacgcgtcctctcgcggtgataagccgattctgctcaagacgatcgcggaccag
gccctggacgactgcagcgtcctggggtgcaacgtaccgtgcctcgtattcgaaaacatg
aaccgtcaattctgcaagatgaaggaaggccgcgatacctggtacggcgatgccttagcg
cggctgacgccggagcagcacgaggagtgcccggtggagtggatggacgcggaggatgtg
ctgttcctgctctacacctccggcagcaccgggaaacccaaggccatcgtgcacacgacg
gcgggctacatggtgtacgcctccaccaccttcatgtacagcttcgactaccacatggac
gacgtgtacttctgcacggctgatattggctggatcacaggccacagctacgtcgtgtat
ggtccgatgatccactgcgccacgtcggtgctgttcgagggtgtgccgaactaccccgac
tactcgcgctggtggcagctcgtcgagaagtacaaggtgtccattctctacaccgcgccc
accgcaatccgctccctcatgcaggccggcgacgactacgtcaaggtgggcaaccgcagc
accctgcgtgtgctgggctccgtcggcgagccgatcaacgtggaggcgtggaagtggctg
cgcgatgtcggcggcgagggccactgcgacgtgtcagacacgtggtggcagactgagacg
ggtggccacatgattacaccgatgccgggctgcacccccatgaagcccggtagtgcaacg
ctgccgttcttcggtgtccagccggttattctcgaccccatgaagctgaatgagaagcag
ggcccagcggagggcctgctcgccattcgtgcgccgtggccaggtatggcccgcaccatc
tacggcgaccacgcacgctttgagaagacctactttgacgtggacgggtactacatgaca
ggcgacggtgctcgccgcgactcggacggctattactggatcacgggccgcgtcgatgac
gtgctgaacgtgagcgggcaccgcatcggcaccagcgagatcgaggacgccgtcaacacc
cacccggcagtggtggagagcgccgtggtcggcttccctcaaagcatcaagggtgagggc
atctacgtcttccttacgttccaccaggggacggaggtgacgcccgagctgctggcggcg
gtaaaggcgactgtgcgcaaggtgattggtccgctggccacgccagatgtgcttcacccc
acgcaggaaggtctgccgaaaacgcgctccggcaagattgtgcgccgcatcttgcgcaag
atcgccactcacaacgacgacgacctgggcgacacctcgaccctggcagaccccaccgtc
gtggaggcgctgaagcgctcgcgtgcaaagtgggtggataaaaagtag

DBGET integrated database retrieval system