KEGG   Leishmania major: LMJF_23_1350Help
Entry
LMJF_23_1350      CDS       T01014                                 

Definition
acetyltransferase-like protein
Orthology
K00653  
histone acetyltransferase [EC:2.3.1.48]
Organism
lma  Leishmania major
Brite
Enzymes [BR:lma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     LMJF_23_1350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
23:651125..653239
Genome map
AA seq 704 aa AA seqDB search
MSDHADIDEAARKRLRAEAPFVSPLPLPPPAAPLLPCDASHNGESAEAAGHILVASAPPH
KEDSVASTLHTSAKEARFEGRCMPPSFHSLLGEYEVPEEAKDVEDLVGGHEDFSDLPEAR
REALLQSVRTLVKKAAGASSAEQLEHLRVKGSRLHGFKDTARKSELTAAYRQLVREGAIA
ENAVVEALLIRKKGKSHSGVLVVTVFMGPGEFSCPKDCHYCPNQPGIARSYLLKEPGVLR
GFRNGWDPISQFYDRASALENNGHVVDKIELIILGGTFSFYPQRYAEEFMTASFYAANTY
YDSAPLRPMRSLAEELTLNEGARCRIIGITAETRPDYISARELRRFRSLGITRVQLGIQH
LDDDILNLINRDCPTAKTVVAIQRLLDAGFKVDAHWMPDLPGSSFEKDMELFETLFSAEN
ESFQVDQWKVYPTATVPFTKISEWYAQGQYKPYAELDNGAYMVKLLVYIMEHCPYRIRLN
RIIRDIPTTYIMGGEKRCNLRQVIEAEMRARHIRCKDIRERECKGNPVDRANTHLFTDEF
RASEGTEFYLSVENKDRTQLYGHLRLRLRDDASREESNILPVLRGCALVRELHTYGKLIA
VSQQNTGRETQHVGVGTQLMREAERIAKERGYHRMAVIAGVGVRRYYAKLGYRLEDTYMV
KELDEQASAITEDQVVQDDDNENSAYSSFLSTIKSFFGFHKNTP
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaccacgccgacatcgacgaggcagcccgcaagcgtttgcgggcggaggctccg
ttcgtctctcctcttcctcttcctcctcctgcagcaccgcttcttccctgtgacgcatcg
cacaacggcgagtcggcagaggcggccggccacatcctggtggcctcggcgccccctcac
aaggaggacagcgttgcgtcgacgttacacacgagcgccaaggaggcccgcttcgagggc
cgctgcatgccgccgtctttccactcgcttctcggcgagtacgaggtgccggaggaggcg
aaggatgtggaagatctcgtgggtggccacgaggacttcagcgacctccccgaggcccgc
cgcgaggcgctcctgcagtccgtgcgcacgctggtaaaaaaggcggcgggggccagctcc
gcggagcagctcgagcacctgcgcgtgaaggggtcgcgcctgcacggcttcaaggacacg
gcgcgcaagtcagagctgacggcggcgtacaggcagctcgtccgcgaaggtgccattgcc
gagaacgccgtcgtcgaggcgctgctcattcgcaagaaaggaaagtcgcacagtggagtg
ctcgtggtgacggtgttcatgggccctggcgagttcagctgccccaaggactgtcactac
tgccccaaccagcccggcatcgcccgcagctacttgctgaaggagccgggcgtgctgcgc
ggcttccgcaacggctgggaccccatcagccagttctacgaccgcgccagcgcgctggag
aacaacgggcatgtcgtggacaagatcgagctcatcatccttggcggtacgttctctttc
tacccccagcgctacgccgaggagtttatgacggcatctttttacgccgctaacacgtac
tacgactcggcgccgctgcggccaatgcgcagcttggcggaggagctgacgctgaacgag
ggcgcgcggtgccgcataatcggcatcacagcagagacgcggcccgactatatcagcgcg
cgcgagctgcgccgctttcgctccctcggcataacacgcgtgcagctcggcatccaacac
ctcgacgatgacatcctgaacctcatcaaccgcgactgccccacggcgaagaccgtcgtc
gcgatccagcggctgctggacgccggattcaaggtggatgcgcactggatgcctgacctg
ccagggagcagctttgagaaggacatggagctcttcgagacgctcttctcagctgagaac
gagtcgttccaggtggaccaatggaaggtgtaccccaccgccaccgtgcccttcaccaaa
atcagcgagtggtacgcgcagggtcaatacaagccctatgcggagctggataacggtgcc
tacatggtgaagctgctggtctacatcatggagcactgtccgtaccgcatccggctcaac
cgcattatccgcgatatcccgacgacgtacatcatgggcggggagaagcgatgcaacctg
cgccaggtgatcgaggctgagatgcgcgcacgccacatccgatgcaaggacatccgcgag
cgcgagtgcaagggcaacccggtcgaccgcgccaacacccacctcttcacggacgagttc
cgcgccagcgaggggacggagttctacctctccgtggagaataaagatcgcacgcagctg
tacgggcatctccgcctgcgactccgcgacgacgcttcaagagaggaaagcaacatcctg
ccggtgctccggggctgtgctctcgttcgcgaactgcacacgtacggcaagctcatcgcc
gtcagccagcagaataccgggcgcgagacgcagcacgtcggcgtcgggacgcaactcatg
cgggaggccgagcgcatcgccaaggagcgtggctaccaccgcatggccgtaattgccggc
gttggtgtgcgccgctactacgcaaaactcggctatcggctcgaggacacgtacatggtg
aaggagctggatgagcaggcgagcgctatcacggaggatcaggtggtgcaggacgacgac
aacgagaactcagcctacagcagcttcctgagcaccataaagtccttctttgggttccac
aagaacacaccctga

DBGET integrated database retrieval system