KEGG   Leishmania major: LMJF_23_1350Help
Entry
LMJF_23_1350      CDS       T01014                                 

Definition
(RefSeq) acetyltransferase-like protein
Organism
lma  Leishmania major
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10
Motif
Other DBs
NCBI-GeneID: 5652130
NCBI-ProteinID: XP_001683481
GeneDB: LmjF.23.1350
UniProt: Q4QB17
Position
23:651125..653239
Genome map
AA seq 704 aa AA seqDB search
MSDHADIDEAARKRLRAEAPFVSPLPLPPPAAPLLPCDASHNGESAEAAGHILVASAPPH
KEDSVASTLHTSAKEARFEGRCMPPSFHSLLGEYEVPEEAKDVEDLVGGHEDFSDLPEAR
REALLQSVRTLVKKAAGASSAEQLEHLRVKGSRLHGFKDTARKSELTAAYRQLVREGAIA
ENAVVEALLIRKKGKSHSGVLVVTVFMGPGEFSCPKDCHYCPNQPGIARSYLLKEPGVLR
GFRNGWDPISQFYDRASALENNGHVVDKIELIILGGTFSFYPQRYAEEFMTASFYAANTY
YDSAPLRPMRSLAEELTLNEGARCRIIGITAETRPDYISARELRRFRSLGITRVQLGIQH
LDDDILNLINRDCPTAKTVVAIQRLLDAGFKVDAHWMPDLPGSSFEKDMELFETLFSAEN
ESFQVDQWKVYPTATVPFTKISEWYAQGQYKPYAELDNGAYMVKLLVYIMEHCPYRIRLN
RIIRDIPTTYIMGGEKRCNLRQVIEAEMRARHIRCKDIRERECKGNPVDRANTHLFTDEF
RASEGTEFYLSVENKDRTQLYGHLRLRLRDDASREESNILPVLRGCALVRELHTYGKLIA
VSQQNTGRETQHVGVGTQLMREAERIAKERGYHRMAVIAGVGVRRYYAKLGYRLEDTYMV
KELDEQASAITEDQVVQDDDNENSAYSSFLSTIKSFFGFHKNTP
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaccacgccgacatcgacgaggcagcccgcaagcgtttgcgggcggaggctccg
ttcgtctctcctcttcctcttcctcctcctgcagcaccgcttcttccctgtgacgcatcg
cacaacggcgagtcggcagaggcggccggccacatcctggtggcctcggcgccccctcac
aaggaggacagcgttgcgtcgacgttacacacgagcgccaaggaggcccgcttcgagggc
cgctgcatgccgccgtctttccactcgcttctcggcgagtacgaggtgccggaggaggcg
aaggatgtggaagatctcgtgggtggccacgaggacttcagcgacctccccgaggcccgc
cgcgaggcgctcctgcagtccgtgcgcacgctggtaaaaaaggcggcgggggccagctcc
gcggagcagctcgagcacctgcgcgtgaaggggtcgcgcctgcacggcttcaaggacacg
gcgcgcaagtcagagctgacggcggcgtacaggcagctcgtccgcgaaggtgccattgcc
gagaacgccgtcgtcgaggcgctgctcattcgcaagaaaggaaagtcgcacagtggagtg
ctcgtggtgacggtgttcatgggccctggcgagttcagctgccccaaggactgtcactac
tgccccaaccagcccggcatcgcccgcagctacttgctgaaggagccgggcgtgctgcgc
ggcttccgcaacggctgggaccccatcagccagttctacgaccgcgccagcgcgctggag
aacaacgggcatgtcgtggacaagatcgagctcatcatccttggcggtacgttctctttc
tacccccagcgctacgccgaggagtttatgacggcatctttttacgccgctaacacgtac
tacgactcggcgccgctgcggccaatgcgcagcttggcggaggagctgacgctgaacgag
ggcgcgcggtgccgcataatcggcatcacagcagagacgcggcccgactatatcagcgcg
cgcgagctgcgccgctttcgctccctcggcataacacgcgtgcagctcggcatccaacac
ctcgacgatgacatcctgaacctcatcaaccgcgactgccccacggcgaagaccgtcgtc
gcgatccagcggctgctggacgccggattcaaggtggatgcgcactggatgcctgacctg
ccagggagcagctttgagaaggacatggagctcttcgagacgctcttctcagctgagaac
gagtcgttccaggtggaccaatggaaggtgtaccccaccgccaccgtgcccttcaccaaa
atcagcgagtggtacgcgcagggtcaatacaagccctatgcggagctggataacggtgcc
tacatggtgaagctgctggtctacatcatggagcactgtccgtaccgcatccggctcaac
cgcattatccgcgatatcccgacgacgtacatcatgggcggggagaagcgatgcaacctg
cgccaggtgatcgaggctgagatgcgcgcacgccacatccgatgcaaggacatccgcgag
cgcgagtgcaagggcaacccggtcgaccgcgccaacacccacctcttcacggacgagttc
cgcgccagcgaggggacggagttctacctctccgtggagaataaagatcgcacgcagctg
tacgggcatctccgcctgcgactccgcgacgacgcttcaagagaggaaagcaacatcctg
ccggtgctccggggctgtgctctcgttcgcgaactgcacacgtacggcaagctcatcgcc
gtcagccagcagaataccgggcgcgagacgcagcacgtcggcgtcgggacgcaactcatg
cgggaggccgagcgcatcgccaaggagcgtggctaccaccgcatggccgtaattgccggc
gttggtgtgcgccgctactacgcaaaactcggctatcggctcgaggacacgtacatggtg
aaggagctggatgagcaggcgagcgctatcacggaggatcaggtggtgcaggacgacgac
aacgagaactcagcctacagcagcttcctgagcaccataaagtccttctttgggttccac
aagaacacaccctga

DBGET integrated database retrieval system