KEGG   Leishmania major: LMJF_24_0010Help
Entry
LMJF_24_0010      CDS       T01014                                 

Definition
putative pyruvate dehydrogenase (lipoamide) kinase
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
lma  Leishmania major
Brite
Enzymes [BR:lma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     LMJF_24_0010
Protein kinases [BR:lma01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   LMJF_24_0010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
24:4496..5947
Genome map
AA seq 483 aa AA seqDB search
MSRLSLPSLGLFVVFVRVLCSCITHVGRADLQMLRRGFCRSIPLLGPTFTELVERLDSFE
KEFIEWKAFRKAVESTSPKVTEAAKEIIAESMKEVKTSKVNLENPLTPEEFTELNQFYAK
QKVKDIFFENLLYINTPNDLMQHSEIVFRQYLVRIARRVRHLNHAPYGLSQMPGIQMLKK
WYQWSFHDVRSTPVPTTRDGCYRCDRMVRRVFLRHYNVSSLITDGMVEFAGREGWTHVDE
EVMHTYDELQHFFEAFCLGRVRLRFLVGNYMYLSTKILGVSREEYAVNDADGLTVPIFFD
HNADDFVGQICKRCSLLVLTKCAIKEAQATYDAEIELKLAGDPSLVFVGVPYITYDIICA
MLEDAVSANVDRQERTGKECTKIEVTLAQWPTNKRFVLRISDTAGGMTLRQASMQLSCWS
LYRNIQGHNQDTISTWTSSPIRLPYAYNAARVIGGNITLASIEGYGTDRQLYLPSTGLAG
VSL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgactttctttgccttcacttggccttttcgttgtttttgtgcgcgttttgtgt
agctgcatcactcacgtcgggagagcagatctacagatgcttcgtcgaggcttttgccgc
agtatcccgctcttgggacccacctttacagagcttgtggagcggctggactcctttgag
aaggagttcatcgagtggaaggcgtttcggaaagcggtcgagtcaacgtctccgaaggtg
acggaggcagcgaaggagattattgcggagagcatgaaggaggtgaagacgagcaaggtg
aacttggaaaacccgctgacgcctgaagagttcacggagttgaaccagttttacgccaag
cagaaggtgaaggatattttcttcgaaaacttgctttacatcaacacaccgaatgacttg
atgcagcattcggagatcgtttttcgacagtaccttgtgcgcattgcccgtcgcgttcgc
cacttgaatcatgccccgtacggcctttcgcagatgccgggaattcaaatgctgaagaag
tggtaccagtggagttttcacgacgttcgcagcactcctgttccaacgacccgagacgga
tgctaccgatgtgaccgcatggtgcggcgcgttttcctacgccactacaacgtgagctct
ctcatcaccgatggtatggtcgagtttgccggccgcgagggatggacgcatgtagacgaa
gaagtgatgcacacgtatgatgagctgcagcactttttcgaagcattttgcctgggtcgt
gtccgtcttcgctttttggtaggcaattatatgtatctgtcaaccaaaatccttggtgtc
tcgagggaggagtacgccgtgaatgacgcagacgggcttacagtgcccatctttttcgac
cataatgcggacgattttgttgggcagatctgcaagagatgctctctgttggtactcacg
aagtgcgcgatcaaagaagcgcaggcgacttatgatgcggagatcgagctaaaactggct
ggggatcctagtttggtctttgtgggggtaccgtatatcacgtatgacatcatttgcgcg
atgctggaggacgccgtgtctgccaacgttgatcgccaggaacggacaggcaaggagtgc
accaaaatcgaagtcacgctggcgcagtggccgacaaacaagcgctttgttctgcgtata
tctgatacggcgggcggaatgaccttacgccaggcttcaatgcagctgtcctgctggtct
ctttacagaaatatccaaggtcataatcaggatacgatttcaacgtggacctcaagtccg
attcggctaccctatgcgtacaatgccgcgcgcgtgattggtgggaacattacgctggcg
tccattgaaggctacggcacggatcggcagctgtatctgccgtctactggacttgctggt
gtgtcgctgtga

DBGET integrated database retrieval system