KEGG   Leishmania major: LMJF_24_0420Help
Entry
LMJF_24_0420      CDS       T01014                                 

Definition
putative ubiquitin carboxyl-terminal hydrolase
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
lma  Leishmania major
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
24:137490..138413
Genome map
AA seq 307 aa AA seqDB search
MPSDESRWCLIESDPAVFREIIQTVGVKGVSVEDLIMLDSSMLEQYEHVYALVLLFKWQS
SEQASPLGTVVKDAPVFFAKQVIHNACATLAIMNTLCNYPDQVELGPKVQRYLSFCQELD
PEMRGSLLDSFDELREAHNSFAPQSAFTKDGPSPKDADVYHFVSFVYRHGHIWELDGLQE
GPLQCREATDANYREALVEVVQRRIDDIAAKDTTGAGQGISFSLMTIVDDPVTVLEKKIA
ALRAEEKPTTALDEELAEMLLLRKKDKEANVRRRHDYNAMIVALLKTLAERGKLEKVVAE
VQAKASK
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcgatgagagccgttggtgtttaatcgagagcgatccggcggtgttcagggag
atcatccaaaccgtcggcgtgaagggggtctccgtggaggacctcattatgctcgactcc
tcgatgctggagcagtacgagcacgtctacgcccttgtgttgctgttcaagtggcagtcg
tcggagcaggcgtcgccgctcggcaccgtcgtgaaggacgcgccggtgttcttcgccaag
caggtgatccacaacgcctgcgccacgctcgccatcatgaacacgctgtgcaactacccg
gatcaggtggagctggggccaaaggtgcagagatacctgagcttctgccaggagctcgac
ccggagatgcgcggctcgcttctagacagctttgatgagctgcgcgaggcacacaactcc
ttcgcgccacaatcggcgtttacgaaagacgggccgtcgccaaaggacgcggatgtgtat
cacttcgtctcctttgtataccgccacggacacatctgggagctcgatgggctgcaggag
ggcccgctgcagtgccgcgaggcgacggacgcgaactaccgagaggcgctcgtggaggta
gtgcagcggcgcatcgacgacattgcagcaaaggacacgacgggtgccgggcagggcatc
tccttctcgcttatgacgattgtggacgacccggtcacggtgttggagaagaagattgcc
gctctccgggccgaggaaaagccgacgacggcgctcgacgaagagctggcggagatgctg
ttgctgcgcaagaaggacaaggaggctaacgtgcgtcgccgtcatgactacaatgccatg
atcgtggcgctgctgaagaccctggcggagcgcggcaagctggagaaggtggtggcggag
gtgcaggcgaaggcctccaagtag

DBGET integrated database retrieval system