KEGG   Leishmania major: LMJF_24_0760Help
Entry
LMJF_24_0760      CDS       T01014                                 

Definition
putative DNA repair and recombination protein RAD54
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
lma  Leishmania major
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lma00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LMJF_24_0760
Enzymes [BR:lma01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     LMJF_24_0760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
24:265169..268552
Genome map
AA seq 1127 aa AA seqDB search
MRKSAAGSGVANGTFRPPTMSSEGTPAERKPRTHPLLPATLAAAVPRFMTGWRALSNGSF
KAPGSGDASNISDDTVDLPGPTVTCVTSTGARREVMYPAVTPHSAGSTAHDDLVAYRLAR
RSQIDYHQPESAAKAVAARALQAAAAARGKTDADSEDSGSQGGGTAKLLKVEAGTGGVKA
APGAPEAAEGGTAAAASEGHETAAAAAANEDAIPADKVVSRYPVSPYGKLYFQVETDGAT
RHESVGIVIIDTELLGAIMYDRVGRQYGNRPDPGYPIKQEEVDSAKAGSVLKVGTKSVLL
ITALTEEAFRSGEFFLRSEHDLRVKEDKAKAEAAAAEEAKARKPGMSFGNSLSNSSAFAS
ILFRRRPKDGETGFVVPVAGRPKMGKNGIIMDELHPLHDPDREKAVVLFRADYKRDVHGR
RQVSVVVDPIIGDKLRPHQIIGVKFLFDCITGERMLGYHGAILADEMGLGKTIQTVATIY
TCLKQGKHGQPTARKCLVVTPSSLVKNWCNEFDKWLGEGAVRHFAISESTPKGDRIISRF
DGDGDVLVISYDQLRKYIDRLSGLRSVELVVCDEGHRLKNAEVKTTKAVDMLPTRNRIIL
SGTPIQNDLSEFHAMVNFVNPGILGNRDLFARVFEEPVSLGRDPGCPDHLKSLGRDRARY
LSVLTQRFILRRTQSINESYLPPKVDVTVFVRLGEKQELAYQKLADVVESAECTPLVLIS
ALRKLCNHMDLFHDAVHLSHQIGNSAGASAQQQQQAGRRRGRSSAAGESQGIPLSVLPKG
FRPGGLSMDCGSKMHFVSLVLDELKGNGEHDKLVIVSNFTQTLDIIAALCNSKQIAYFQL
DGSTPIKKRQQLVDYFNVPGSQEIVFLLSSKAGGVGLNLIGANRLILFDPDWNPANDAQA
MGRVWRDGQKKCVFIYRLLSTGTIEEKIYQRQVSKQGLSANVVDMQEDSKQHFTLEELKS
LFKYKADTLCDTHDLLGCTSCEAAESLATSGRGSRGKQAEQIKMQFRKVGQPKKKSGPRM
DELKAWRHISAVASFNLDSVTRAVAKHAPSLLSFLFADERDNTKVAGPAVSTRVKVDKPA
FEEDEETITCASQAAMQQQESEMEIELIDDDDDEEEAELESSEEVSD
NT seq 3384 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagtcagcggcaggtagcggcgttgccaacggcacgttccgccctcccacaatg
agtagtgagggtacgccggcagagcgcaagcccaggacgcacccactattgcctgccacc
ttggctgcagccgtgccgcgcttcatgaccggttggcgggccctcagcaacggcagcttc
aaggcacccggttcaggggatgccagcaacatcagtgacgacaccgtggatctgcctggc
ccgactgtgacctgtgtcacctccactggcgctcggcgcgaggtgatgtaccccgccgtc
accccacatagcgcgggcagcacggcacacgacgaccttgtggcttaccggctggcacgg
cgcagccagatagactaccaccagccggagtcggccgccaaggcggtggccgcgcgggcc
ctccaagctgccgcggcagcgcgagggaagacggacgcggactctgaggacagcggaagc
cagggaggcggcactgcgaagctgctcaaggtggaggctggcaccggaggcgtgaaggcg
gctcctggtgcgccggaggctgccgaaggtggcacggcagcggcagccagcgagggccac
gagaccgctgccgccgccgctgcgaacgaggacgctattccagcggacaaagtggtgagc
cgctaccccgtcagcccctatggcaagctgtacttccaggtggagacggacggcgcgacg
cggcatgaatctgtcggcatcgtcatcatcgatacggagttgctgggggctattatgtat
gaccgcgtggggcggcagtacggcaaccggcccgaccctggttacccgatcaagcaggag
gaagtggacagtgcgaaggcgggcagcgtcttgaaggtgggcacaaagagtgtgctgctc
atcacggcgctcaccgaggaggcgttccgcagcggcgagttcttcttgcgctccgagcac
gacctccgcgtgaaggaggacaaggccaaggccgaggccgcggccgccgaggaggcgaag
gcgcggaagcccgggatgagcttcggcaactcgctcagcaacagcagcgccttcgcctcc
atcctgttccgccgtcgccccaaggatggggagacgggcttcgtcgtccccgtagccggg
cgtccaaagatgggcaagaacggtatcatcatggacgagctgcacccgctgcacgacccg
gaccgcgagaaggcggtggtgctgttccgcgccgactacaagcgcgacgtgcacggccgt
cggcaagtctccgtcgttgtggacccgatcattggcgacaagctgcggccgcaccaaatc
attggtgtaaagtttctcttcgactgcatcacgggtgagcgcatgctcggctaccacggc
gccatcctggccgatgaaatgggcttgggtaagacgatccagacggtggccaccatctac
acctgtttgaagcaaggcaagcacggccagccaacggcccgcaagtgcctcgtcgtgacg
ccgtcctcgctggtgaagaactggtgcaacgagtttgacaagtggctgggcgaaggggca
gtgaggcatttcgccatctccgagtcgaccccgaagggggaccgcattatttcccgcttc
gacggcgatggcgacgtcctcgtcatctcgtacgaccagctgcgcaagtatatagaccgc
ctctcggggttacgctctgtcgaactggtcgtctgcgacgagggtcaccgcctcaagaat
gcggaggtgaagacgacaaaggcggtggacatgctgccgacgcgcaaccgcatcatcctt
tccggcacccccatccagaacgacctgtccgagttccatgccatggtcaacttcgtcaac
cccggtatcctcggcaaccgcgacctcttcgcacgcgtcttcgaagagcccgtctccctt
ggccgcgacccgggatgcccagaccacctcaaatctcttggccgcgatcgcgcgcgttac
ctctcggtgctgacgcagcgctttatccttcgccgcacgcagtccatcaatgagtcctac
ctgccgcccaaggtggacgtcaccgtcttcgtgcggctgggagagaagcaggagcttgcc
tatcagaagctggccgacgtggtcgagtctgccgagtgcacgccgctggtgctcatttcc
gccctgcggaagctgtgcaaccacatggatctcttccacgacgcggtacacctgtctcat
cagatcggcaactcggcaggtgcgtcggcgcagcagcaacagcaggctggccgccgtcgc
ggccgcagcagtgctgcaggtgaatcgcaaggcattcccctctctgtgctaccgaagggg
tttaggccgggtggcttgagcatggactgtggcagcaagatgcattttgtgtccctcgtg
ctcgacgagctgaagggaaacggcgagcacgataagcttgtcattgtgtcgaacttcacg
caaacactcgacatcattgcggcgctgtgtaactcgaagcagatcgcgtacttccagctt
gatggcagcacgcccatcaagaagcgccagcagctagtcgactacttcaacgtgcctggc
tcgcaggagatcgtgtttctgctctcctcgaaggccggcggtgtcgggctgaacctgatc
ggtgcgaaccggctgatcctcttcgaccctgactggaaccccgcaaacgatgcgcaggcg
atgggccgtgtgtggcgcgatggccagaaaaagtgcgtcttcatctatcgcctgctcagc
accggcaccatcgaagagaaaatctaccagcggcaagtgagcaagcaaggcttgtcggcg
aacgtggtggacatgcaggaggattcaaagcagcacttcacgctggaggagctcaagtcc
ctcttcaaatacaaggccgacacgctgtgcgacacccacgacctgctgggctgcacatcc
tgcgaggccgccgagtcgttggccacgagcggccgcggcagccgcggcaagcaggcagaa
cagatcaagatgcagttccgaaaggtgggccagccaaagaagaagagtgggccacgcatg
gatgagttgaaagcgtggcgccacatcagcgccgttgcctcgttcaaccttgacagcgtt
acccgcgccgtggcgaagcacgcgccatcgcttctctcctttctcttcgctgacgagcgc
gataacaccaaggttgccgggcccgccgtgtcgacccgcgtgaaggtcgacaagcccgcc
ttcgaggaggacgaggagacgatcacgtgtgccagccaagccgccatgcagcagcaggag
agcgagatggagattgagctgatcgacgacgacgatgacgaagaagaggcggaactcgaa
tcgtccgaagaggtcagtgactag

DBGET integrated database retrieval system