KEGG   Leishmania major: LMJF_24_0850Help
Entry
LMJF_24_0850      CDS       T01014                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lma  Leishmania major
Pathway
lma00010  Glycolysis / Gluconeogenesis
lma00051  Fructose and mannose metabolism
lma00562  Inositol phosphate metabolism
lma01100  Metabolic pathways
lma01110  Biosynthesis of secondary metabolites
lma01130  Biosynthesis of antibiotics
lma01200  Carbon metabolism
lma01230  Biosynthesis of amino acids
Module
lma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lma_M00002  Glycolysis, core module involving three-carbon compounds
lma_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMJF_24_0850
   00051 Fructose and mannose metabolism
    LMJF_24_0850
   00562 Inositol phosphate metabolism
    LMJF_24_0850
Enzymes [BR:lma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LMJF_24_0850
Exosome [BR:lma04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LMJF_24_0850
  Exosomal proteins of bladder cancer cells
   LMJF_24_0850
  Exosomal proteins of melanoma cells
   LMJF_24_0850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 5652250
NCBI-ProteinID: XP_001683600
GeneDB: LmjF.24.0850
UniProt: Q4QAP8
Position
24:300571..301326
Genome map
AA seq 251 aa AA seqDB search
MSAKPQPIAAANWKCNGTTASIEKLVQVLNEHNISHDVQCVVAPTFVHIPLVQAKLRNPK
YVVSAENAIAKSGAFTGEVSMPILKDLGINWVILGHSERRTYYGETDETVAQKVADACKQ
GFMVIACIGETLQQREANQTAKVVLSQTSAIATKLPKEAWDQIVLAYEPVWAIGTGKVAT
PEQAQEVHALLRKWVSEKIGTDVAAKLRILYGGSVSAGNAKTLYMKPDINGFLVGGASLK
PEFRDIIDATR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccaagccgcagccgatcgctgctgcgaactggaagtgcaacggcaccaccgcc
tctatcgagaagctggtgcaggtgctcaatgaacacaacatctcccatgacgtgcagtgc
gtcgtggcaccgacctttgtgcacatcccattggttcaggcgaagctccgcaaccccaag
tacgtcgtcagcgccgagaacgcgatcgccaagagcggcgccttcaccggtgaagtgtca
atgccgatcctgaaggacctgggcatcaactgggtcattcttggccactcggagcgccgc
acctactacggtgagacggatgagaccgtagcgcaaaaagttgcggatgcgtgcaagcag
ggcttcatggtgattgcttgcattggagagacgctgcagcagcgtgaagcgaaccagaca
gcgaaggtggtgttgagccagacgtcagcgatcgccacgaagctgccgaaggaggcgtgg
gaccagattgtgctcgcctacgagccggtatgggccatcggcaccggcaaggtcgccacg
cccgagcaggcgcaggaggtgcacgccctgttgcgcaagtgggtgagcgagaagatcggc
accgacgtcgccgcgaagctccgcatcctgtacggcggctctgtcagcgccggcaatgcc
aagacgctctacatgaagcctgatatcaacggcttcctggtcggtggcgcgtccctgaag
ccggagttccgagacatcatcgatgcaacccggtaa

DBGET integrated database retrieval system