KEGG   Leishmania major: LMJF_24_0850Help
Entry
LMJF_24_0850      CDS       T01014                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lma  Leishmania major
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LMJF_24_0850
   01230 Biosynthesis of amino acids
    LMJF_24_0850
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMJF_24_0850
   00051 Fructose and mannose metabolism
    LMJF_24_0850
   00562 Inositol phosphate metabolism
    LMJF_24_0850
Enzymes [BR:lma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LMJF_24_0850
Exosome [BR:lma04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LMJF_24_0850
  Exosomal proteins of bladder cancer cells
   LMJF_24_0850
  Exosomal proteins of melanoma cells
   LMJF_24_0850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
24:300571..301326
Genome map
AA seq 251 aa AA seqDB search
MSAKPQPIAAANWKCNGTTASIEKLVQVLNEHNISHDVQCVVAPTFVHIPLVQAKLRNPK
YVVSAENAIAKSGAFTGEVSMPILKDLGINWVILGHSERRTYYGETDETVAQKVADACKQ
GFMVIACIGETLQQREANQTAKVVLSQTSAIATKLPKEAWDQIVLAYEPVWAIGTGKVAT
PEQAQEVHALLRKWVSEKIGTDVAAKLRILYGGSVSAGNAKTLYMKPDINGFLVGGASLK
PEFRDIIDATR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccaagccgcagccgatcgctgctgcgaactggaagtgcaacggcaccaccgcc
tctatcgagaagctggtgcaggtgctcaatgaacacaacatctcccatgacgtgcagtgc
gtcgtggcaccgacctttgtgcacatcccattggttcaggcgaagctccgcaaccccaag
tacgtcgtcagcgccgagaacgcgatcgccaagagcggcgccttcaccggtgaagtgtca
atgccgatcctgaaggacctgggcatcaactgggtcattcttggccactcggagcgccgc
acctactacggtgagacggatgagaccgtagcgcaaaaagttgcggatgcgtgcaagcag
ggcttcatggtgattgcttgcattggagagacgctgcagcagcgtgaagcgaaccagaca
gcgaaggtggtgttgagccagacgtcagcgatcgccacgaagctgccgaaggaggcgtgg
gaccagattgtgctcgcctacgagccggtatgggccatcggcaccggcaaggtcgccacg
cccgagcaggcgcaggaggtgcacgccctgttgcgcaagtgggtgagcgagaagatcggc
accgacgtcgccgcgaagctccgcatcctgtacggcggctctgtcagcgccggcaatgcc
aagacgctctacatgaagcctgatatcaacggcttcctggtcggtggcgcgtccctgaag
ccggagttccgagacatcatcgatgcaacccggtaa

DBGET integrated database retrieval system