KEGG   Leishmania major: LMJF_24_1370Help
Entry
LMJF_24_1370      CDS       T01014                                 

Definition
putative histone deacetylase
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
lma  Leishmania major
Brite
Enzymes [BR:lma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     LMJF_24_1370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
24:487535..489145
Genome map
AA seq 536 aa AA seqDB search
MSSPEQLPALSAAGSSSSRVASSHHSPHEASLPFPASAIPGDASAESPRASSMSRSSRAS
EESAATSPLQRKPDAPMPRLGGRKVLYFVDHSVTAIAYAEGHLMRPSRVRALHALVHSLG
LDNAECMTVCHARPATAEEMGAFHRSAYLECLRQAPVICGNPLDEMSLAFQKEFDVPFAS
QDSDCPLFPEVWALVSSQAGASLACAEALVRGDATVAMNWAGGMHHAAAAHASGFCFVND
IVLCIRRLLRYYQRVLYVDLDVHHGDGVEGAFYGNHRVMTLSLHQFGNGFFPGTGDYPTR
ETADSFAINVPLPTRTGDAAYLLSFRTALSSVVQCFDPEAMVVQCGADTIAGDLIGRLCV
TTLAHTQCVADVLSLERPTVLLGGGGYHVFHTARCWAIHTATALGRTAAQLPLYIPRTDP
YYMDYRRECTPKRPTLHVFLDPDVDDPLPLGDSLAFWRQLCCSIQWQMHTARLVRQGFTR
TLQLCRQRRAALLRQFATQEAGRESGIGVSGPKRPRSANATDRDANEGVEDRVVSA
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctcccgagcaacttcctgcgctctcagcggcgggctcatcgtcgtcgagagtg
gcttcctcgcatcactcaccgcatgaagcatcgctcccgtttcccgcatcagcgattcct
ggcgacgcctctgcggagtctccgcgcgcgtcgtcgatgtcacggtcttcaagggcgagc
gaggagagcgcagcaacatcgccactgcagcgaaagccagatgcaccgatgccacgcctt
ggggggcggaaggtgttgtactttgtggatcactctgtcactgcgatagcctatgcagag
ggtcatttgatgcggccgtctcgtgtgcgtgcgctgcacgcgcttgttcattccctgggc
ctcgacaatgcagaatgcatgactgtatgtcatgctcgtccggcgacggcggaggagatg
ggggcgttccaccgcagcgcgtacttggaatgtctgcggcaggcaccggtcatttgcggg
aatccgctggacgagatgtccctggcttttcagaaggaattcgacgtcccgttcgcgtct
caggacagcgactgtcctctcttccctgaggtgtgggcgctggtatccagccaagccggc
gcctcgcttgcctgtgcagaggcccttgtacgcggcgatgccacagtggcgatgaactgg
gcaggtggcatgcatcacgctgctgccgcccatgcgagcgggttctgctttgtgaatgac
attgtgttgtgcatccgccggctgctgcggtactaccagcgcgtcctctacgttgacctg
gacgtgcatcacggggacggcgtggagggggccttttatggcaatcaccgcgtgatgacg
ctctcgctgcaccagttcggcaacggcttcttccccggcaccggcgactacccgacgcgt
gagacggccgacagcttcgccatcaacgtcccgctgcccacgcgcacgggagatgccgcg
tacctcttgtcgttccgcactgcactctccagcgtggttcagtgctttgatccggaggcg
atggtcgtgcaatgcggcgcggacaccatcgcgggcgacctcattgggcggctttgcgtg
actacgctggcgcacacgcagtgtgtggccgatgtgctgtcgcttgagcgaccgacggta
ctgcttggtggaggcggttatcacgtgtttcacacagcgcgctgctgggcgatccacact
gccaccgcgctgggtcgcacagctgcacagttgcccttgtacatcccgcgcacagacccc
tactatatggattaccggcgcgaatgcacaccgaagcgtccgacgctgcatgtgtttctc
gaccctgacgtcgatgatccgctgccactgggggacagcttggcgttctggcgtcagctc
tgttgcagcatccagtggcagatgcacactgcccgccttgtgcggcaggggtttacccgt
acactacagctttgccggcagcgacgggcagcgttgctgaggcagttcgctacgcaagag
gcagggcgggaatctggtatcggtgtcagtggccctaagcgcccgcgctcagcaaatgca
accgaccgcgatgccaacgagggtgtggaggaccgagtggtctcggcgtga

DBGET integrated database retrieval system