KEGG   Leishmania major: LMJF_24_1840Help
Entry
LMJF_24_1840      CDS       T01014                                 

Definition
putative lysophospholipase
Orthology
K06128  
lysophospholipase I [EC:3.1.1.5]
Organism
lma  Leishmania major
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:lma00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    LMJF_24_1840
Enzymes [BR:lma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     LMJF_24_1840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
24:complement(677392..678228)
Genome map
AA seq 278 aa AA seqDB search
MTVPIDQLTNAQIKEELRTLYAVTDFADCIEHGDLQKKLQAIRNSTPITHGLRYGTLLEI
GNKNPTGVVTLVHGLGDSAYGWESVGHELLRRLPHLLFLLPTAPSRSVTINGGMPMPAWY
DIMDMCNSGLLRGRQDAASVRQSCDYVRSIAHVATKKYGIPPQRVVYSGFSQGAAISLCT
GLTAHIAPAGIACMSGYLAACTDVLPRIVQKAVPITMFHGRQDPVVPISAAKETKEILEK
DGGVAPISFLEYDMDHSTLPQEIDDITSFLSRVLPEKF
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgccgatcgaccagctcacgaacgcgcagattaaggaggagctgcgcacgttg
tacgccgtcaccgacttcgccgactgcatcgagcacggcgatcttcagaagaagctgcag
gcaattcgtaactcgacccccatcactcacggcctccgctatggcacgctgctggagatc
ggtaacaagaatccgaccggcgtcgtcaccctcgttcacggtctgggcgactccgcgtac
ggctgggagagcgtcggccacgaactcttgcgccgcctgcctcaccttctctttctgctg
cctaccgccccgtcacggagcgtgacgatcaacggcggcatgccgatgcctgcttggtac
gacatcatggacatgtgcaacagcggcctgctccgcggccggcaggatgccgcctccgtc
cgacagtcctgcgactatgtgcgtagcattgcccacgtggcgacgaagaagtatggcatc
ccgccgcagcgtgttgtctacagcggcttctcccagggcgcggccatctcactctgcact
gggctgacggcgcacatcgccccggctggcatcgcgtgcatgtccggctacctagctgcg
tgcacggatgtgctgccgcgcattgtgcagaaggctgttcctatcaccatgttccacggc
cgtcaagaccccgttgtgcccatttctgccgcgaaggaaacgaaggagattttggagaag
gacggcggtgtcgccccgatcagcttcctggagtacgacatggatcactccaccctcccg
caggagatcgacgacatcacctcgtttttatctcgcgttctgccggagaagttctaa

DBGET integrated database retrieval system