KEGG   Leishmania major: LMJF_25_0190Help
Entry
LMJF_25_0190      CDS       T01014                                 

Definition
putative ubiquitin carboxyl-terminal hydrolase
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
lma  Leishmania major
Brite
Enzymes [BR:lma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     LMJF_25_0190
Peptidases [BR:lma01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   LMJF_25_0190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
25:complement(58187..58888)
Genome map
AA seq 233 aa AA seqDB search
MWFPLESNPQVMNRYISTLGLTEAKVEFVDVYGVSGDLLEMVPSPVHALLLVYPICEATE
RRLAEQQAAQTEEVAALRQAHPFFFTHQLVPNACGTIAIAHALMNNRDKLGEIAAGSILD
GPWVNAAKTSEDPKIIGKLIAEDTSLASAHAAAAQEGATANQHIDADINLHFVCFIPVGG
RCVELDGRKENPTLHGSCTDNKSFLTAAAAAIQERIELNPSSYEFGITALVNK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtggttcccgctggagagcaatccgcaggtgatgaaccgctacatcagcaccttgggt
ctcacagaagcgaaggtggagtttgtggacgtgtacggggtgtcaggcgatctacttgaa
atggtgccttcgccggtgcacgccctgctcctcgtgtaccccatatgtgaggccacagag
agacgcctagcggagcagcaggctgcacagacagaggaagttgcggcgcttcgccaagca
cacccttttttcttcacacaccagctcgttccgaacgcgtgcggaaccatcgccattgcg
catgctctcatgaacaaccgcgataagctcggtgagatcgccgccggcagcatcctcgac
ggcccgtgggtgaacgcggcaaaaacgtcggaagatcccaagatcatagggaaactgatt
gcggaagacacgagtctcgccagcgctcacgccgctgctgcacaggagggcgcgaccgcc
aaccagcacatcgacgcggacatcaaccttcactttgtctgcttcatccccgtaggcgga
cgctgcgttgaactggatgggcgaaaagaaaacccgaccttgcacggtagctgcaccgac
aacaaatctttcctcaccgctgcagccgccgccatacaggaacgcatagagctcaacccc
agctcctacgagtttggcatcaccgcactcgtgaacaagtga

DBGET integrated database retrieval system