KEGG   Leishmania major: LMJF_25_2120Help
Entry
LMJF_25_2120      CDS       T01014                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
lma  Leishmania major
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:lma00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    LMJF_25_2120
Translation factors [BR:lma03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    LMJF_25_2120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
25:complement(815258..815893)
Genome map
AA seq 211 aa AA seqDB search
MDDYHDDDVHSNYGYEDDEYDDAADDWEAEAAEEEQRAVAEEAARQARLEKKLATRAPVK
KEEEEEAVPEDVERAMADMRQVANDIASGSALLSGGDSEELIGNHKLASDADVERVGTMI
ADRLTSFSDSGHYDKLIVEVFQRLTNHLTSTHLLNEEADRVHRLREELKRAAKAKLKPVE
KAPVTQSGLDLDNFEDRGGAAVADNEDETGW
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggacgactaccacgacgatgatgtgcacagcaactacggatatgaagatgacgagtac
gacgacgccgcggatgactgggaagccgaggccgcagaggaagagcagagggccgtcgcc
gaggaggcagctcgacaagcccgcttggaaaagaagctggccacgcgtgctccggtgaag
aaggaagaggaggaggaggcagtaccagaggatgtggagcgcgcgatggctgatatgcgg
caggtggccaacgacatcgcctcgggtagtgctcttctctccggaggagattcggaggag
ctgattggaaaccataagctggcttcagatgcggatgttgagcgggtaggcaccatgatt
gcagaccgtctcacgtccttttccgactccggccactacgacaagctgatcgtcgaagtt
tttcagcgcttgaccaaccacctgacaagcacgcatctcctgaacgaggaagcagacagg
gtacaccgtctgcgcgaggagctcaagcgcgcagcgaaggcaaagctgaagccggtagag
aaggcgcctgttacgcagagcggcctcgatctcgataacttcgaggacaggggtggcgcc
gccgtcgcggataacgaagacgagacgggctggtag

DBGET integrated database retrieval system