KEGG   Leishmania major: LMJF_26_0660Help
Entry
LMJF_26_0660      CDS       T01014                                 

Definition
putative protein disulfide isomerase
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
lma  Leishmania major
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:lma00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    LMJF_26_0660
Enzymes [BR:lma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     LMJF_26_0660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
26:complement(184073..185206)
Genome map
AA seq 377 aa AA seqDB search
MTRRLSVVLALVLVVFVLAGSCSSEDPGAVMPGIVQMSKDNFDQLVGKEKAVLVEFYAPW
CGHCKSMAPEYAALGAAYEASTNAKDLLLVGKVDATQDSDLGKRFGVTGFPTILYFAPGS
LEPEKYKGGRTAEDFAKYLSSAIAGLRLTIPIEPQFAMELVHTNFDAVVKDPSKAVLVMF
YAPWCGHCKALKPIYNTLAKVFSNDKDVVIARINADDAANRKIATEYAVAGFPTVYFFPK
GADEKPVEYKNGRNLEDFLTFVNENAGKHRLANGDFSWECGVIAELAEAVALVATSSGES
SKAAVEAVKAAAAKLAESEDAAYYIKAAERIAAKGPAYVESESARLKRTLGGSVAGDRRD
NMVRRLNILTSIQKHMK
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgacacgccggcttagtgttgtgctggcgctcgtgctcgtggtcttcgtgctcgcgggg
tcgtgcagcagcgaagacccgggtgctgtgatgccgggtatcgtgcagatgagtaaggac
aacttcgaccagctcgttggcaaggagaaagccgtactggtggagttttacgcgccgtgg
tgcggccactgcaagagcatggcccccgagtacgcggctctgggcgcggcctacgaagcg
agcacgaacgcgaaggacctgctgctggttggtaaggtggacgccacgcaggacagcgac
ctcggcaagcgctttggcgtcacggggttcccgacaattctctacttcgctcctggctca
ttggagccggagaagtacaagggcggccgcacggccgaggacttcgccaagtacctctcg
agtgcaattgcgggcctgaggctgaccatcccgattgagccacagtttgcgatggagctg
gtgcacacgaatttcgatgcagtcgtcaaggacccgtcgaaggcggtgctcgtcatgttc
tacgccccgtggtgcggccactgcaaggcgctgaagccgatttacaacacgctggccaag
gtgttctcaaacgataaggatgtcgtgatcgcccgcatcaacgccgacgatgccgccaac
cgaaagatcgccaccgagtacgctgttgccggctttccgacggtgtacttctttcccaaa
ggtgccgacgagaagccggtcgagtacaagaatggccgcaacctggaggactttctcacc
tttgtgaacgagaacgccggcaagcaccgcctcgctaacggagacttctcatgggagtgc
ggcgtcatcgcagagctcgcggaggcggtcgcgctcgtggcgacgagctccggcgagagc
tccaaggcagcagtagaggcggtgaaggcggccgctgccaagctggccgagagcgaggat
gccgcgtactacatcaaggcagcggagcgcatcgcggcgaagggccccgcgtacgtggag
agcgaatcggctcgcctcaagcgcaccctcggaggctccgtggctggcgaccgccgtgat
aacatggtgaggcgcctgaatattctgacctcgatccagaagcacatgaagtag

DBGET integrated database retrieval system