KEGG   Leishmania major: LMJF_26_2710Help
Entry
LMJF_26_2710      CDS       T01014                                 

Definition
putative glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
lma  Leishmania major
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LMJF_26_2710
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LMJF_26_2710
Enzymes [BR:lma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LMJF_26_2710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
26:1088377..1089171
Genome map
AA seq 264 aa AA seqDB search
MADILKSVKRIVVKVGSSILVDNQEIAAHRIEALCKFIADLQTKYEVILVTSGAVAAGYT
QKEMDKAYVPNKQALASMGQPLLMHMYYTQLQKHGILCAQMLLAAYDLDSRKRTMNAHNT
IEVLISHKVIPIINENDATALHELVFGDNDRLSALVAHHFKADLLVILSDIDGYYTENPR
ASTDAKIRSVVHELSPDDLVAEATPNNPFATGGIVTKLQAAQFLLERGGKMYLSSGFHLE
KAREFLFGGSHEIGTLFYPRGSSS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggcggacatcttgaagtcggtgaagcgcatcgtggtgaaagtgggctcctcgatcctt
gtggacaatcaggagatcgccgcgcaccggatcgaggcgctatgcaagtttatcgccgac
ctccagacgaagtatgaagtgatccttgtcacctccggcgcagtagccgcggggtacaca
caaaaagagatggacaaggcatatgtgccgaacaagcaggcacttgcgtcgatggggcag
ccactgctcatgcacatgtactacactcagctccaaaagcacggcatcctgtgcgcgcag
atgctgcttgctgcctatgatctggactcgcggaaacgtacgatgaacgcccacaatacc
attgaggtactcatcagccacaaggtgatcccgatcatcaacgaaaacgacgcgacggcg
ctgcacgagctggtctttggtgacaatgaccgtctgtccgcgcttgtcgcgcaccacttc
aaggcggacctacttgtcattctcagcgacatcgacggctactacaccgaaaatcctcgc
gcctccaccgatgccaagatacgctctgtcgtccacgaacttagccctgacgatcttgtg
gcggaggccacgccgaacaatccgttcgcgacgggtgggatcgtaacgaagctgcaggct
gctcaattcctcctagagaggggaggaaagatgtacctctcgagcggattccacttggag
aaggcgcgcgagttccttttcggcggctcgcacgagattggtaccctgttttatccaagg
ggctcctcgtcttga

DBGET integrated database retrieval system