KEGG   Leishmania major: LMJF_27_0420Help
Entry
LMJF_27_0420      CDS       T01014                                 

Definition
(RefSeq) putative ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
lma  Leishmania major
Pathway
lma00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lma00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LMJF_27_0420
Enzymes [BR:lma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LMJF_27_0420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Mur_ligase Gly_reductase DUF5100
Motif
Other DBs
NCBI-GeneID: 12982633
NCBI-ProteinID: XP_003721848
GeneDB: LmjF.27.0420
UniProt: E9AD19
Position
27:117107..118096
Genome map
AA seq 329 aa AA seqDB search
MHRVQNVQSHVGEYAPDILVVGSCFLDYVGYVDHMPQVGETMHSESFHKGFGGKGANQAV
AAGRLGAKVAMVSMVGTDGDGSDYIKELERNGVHTAYMLRTGKSSTGLAMILVDTKSSNN
EIVICPNATNYFTPELLRAQTSNYEKILHTGLKYLICQNEIPLPTTLDTIKEAHSRGVYT
VFNSAPAPKPAEVEQIKPFLPYVSLFCPNEVEAALITGMKVTDTESAFRAIKALQQLGVR
DVVITLGAAGFALSENGAEPVHVTGKHVKAVDTTGAGDCFVGSMVYFMSRGRNLLEACKR
ANECAAISVTRKGTQLSYPHPSELPAGVT
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgtgtgcagaacgttcaatctcatgtgggcgagtatgccccagacattttggtg
gttggttcctgctttctggactacgttggctacgtagaccacatgccgcaggtgggcgag
acgatgcactcggagtcgtttcacaaggggtttggcggcaagggcgccaaccaagctgtg
gcggctggccgcttgggggccaaggttgccatggtgagcatggtcgggacagatggcgac
ggcagtgactacatcaaggagctggagaggaacggtgttcacacggcgtacatgcttcgc
accggcaagagctcgactgggctggcaatgatcctggtcgataccaagtcgtccaacaac
gaaatcgtcatttgtcccaacgccacaaactacttcacacccgagctgctgcgcgcgcag
acgagcaactacgagaagatcctgcacaccgggctcaagtatcttatttgtcagaacgag
ataccccttcccaccacgctcgacacgatcaaggaggcgcacagccgtggcgtgtacaca
gtgttcaacagcgctccggccccgaagccggctgaggtggagcagattaagccgtttctc
ccgtacgtatcgctcttctgcccgaacgaagtggaggctgcgctcatcaccggcatgaag
gtgacagacaccgagtccgcctttcgcgccatcaaggcgctgcagcagctcggcgttcgt
gatgtcgtcatcacgctcggtgcggccggctttgctctttctgaaaacggtgccgagccg
gtgcatgtcacgggaaagcacgtcaaggcggtggacacgaccggcgccggtgactgcttt
gtcggctccatggtgtatttcatgagccgcggccgcaaccttctggaggcctgcaagcga
gccaacgagtgcgctgccatcagcgtcacgcgcaagggcacacagctgtcctacccgcac
ccaagtgagctgccggctggtgtcacgtag

DBGET integrated database retrieval system