KEGG   Leishmania major: LMJF_27_2340Help
Entry
LMJF_27_2340      CDS       T01014                                 

Definition
(RefSeq) sucrose hydrolase-like protein
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
lma  Leishmania major
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lma00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LMJF_27_2340
   00500 Starch and sucrose metabolism
    LMJF_27_2340
Enzymes [BR:lma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     LMJF_27_2340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
GeneDB: 
UniProt: 
Position
27:1062087..1063556
Genome map
AA seq 489 aa AA seqDB search
MSHEQRIEEANNAVLAIRKSVDKEFYPHYHIAPFARSMSAPCGMIYFKGLYHVFYQHQPF
AEALGPMHWGHSTSEDMVYWRHHPIALAPGEDWDRDGCFSGSSVVYDDRLYVFYTGHHWL
TDIADDSQIYQVQCLAISENGFNFEKRGIVVKPPAGFSHFRDPYVWFQDGRWWMVCGGRD
SKDQGQLLLYSTDDLEDWDDSTFMILSKSEDRNVYMWEHPCFFPLQRHQMLMFSPQGMQP
EDYMFRNRYQTGLLIGLWKPNAIFSVTSTFKKLDLGHDFYGAQTFLTRDGRRVFIGWLDM
WDANMPTKQHHWTGMLSLPRVLLVEEASGRIRTPPIKELESIRGNHKYLPRQTVRNNSQV
PLLFDCTSYEVCVLFDMEASTAEKYGLWLGRGLEIYVDEQSKRLVVNRHYPNYGISGYRS
YALPAQALLLVHAYFDMSSVEVFVNEGEAVLSTRIYPAREDRALSLFAANGTAHITRGDI
WALNQSVMQ
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgtcacacgaacagcggattgaagaggcgaacaacgccgtgctggcgatccgcaaaagc
gtcgacaaggagttttacccgcactatcacattgccccttttgcccgttccatgagtgcg
ccatgtggcatgatctactttaagggcctctatcacgtcttttatcagcatcaaccattt
gctgaagcgctgggcccgatgcactggggtcattccacgagcgaggatatggtgtactgg
cggcaccaccccatcgcgctcgcacccggagaggactgggatcgcgatggctgcttctct
ggcagctcggtcgtgtacgatgaccgactctatgtattttacactggccaccactggctc
actgatattgctgatgatagccaaatatatcaggttcaatgcctggctatcagcgaaaac
gggttcaattttgagaagcggggcatcgtggtaaagccgccagccggcttctcccatttc
cgggacccgtacgtgtggttccaggatgggcggtggtggatggtgtgtggcggtcgcgac
tccaaggaccagggccaacttctcctgtacagcaccgatgacctggaggattgggatgac
agcacattcatgattctgtccaaatcggaggaccgtaacgtgtacatgtgggagcaccct
tgctttttccctctgcagcgccaccagatgctcatgttctcgccgcaaggcatgcagcct
gaagattacatgttccgcaatcggtatcaaacagggcttctgataggtctgtggaaaccg
aacgcgatctttagcgtcacctccaccttcaagaagctggaccttggccacgacttttac
ggcgctcagaccttcctaacgcgcgacggccgacgtgtgttcattggctggctggacatg
tgggacgcaaacatgcccacaaagcagcatcattggaccggcatgctctctttgcctcgc
gtcctccttgttgaggaagctagtggtagaattcgcacgccgcccatcaaggagctggag
agtatccgtggcaaccacaagtacctaccgcggcagactgtgcgcaacaattcgcaggtt
ccgttactgttcgactgcacatcttacgaggtatgcgtactgtttgacatggaagcgagc
acggcggaaaagtacggcctgtggcttggtagagggctagagatctacgtcgacgaacag
agcaagcgtctcgtggtaaaccgccactaccccaactacggcattagcggataccgcagc
tacgcgttgccggcgcaggcgttgctgctagtgcacgcgtactttgacatgtctagcgta
gaagtctttgtgaacgaaggcgaggccgtgctaagtactcgcatttatccggcgcgcgag
gatcgggcgctttctctctttgcagccaatggcaccgcccacatcacgcgaggtgacatt
tgggcgctgaaccagtcagttatgcagtag

DBGET integrated database retrieval system