KEGG   Leishmania major: LMJF_28_0210Help
Entry
LMJF_28_0210      CDS       T01014                                 

Definition
histone H2B variant
Orthology
K11252  
histone H2B
Organism
lma  Leishmania major
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
28:65650..66078
Genome map
AA seq 142 aa AA seqDB search
MPPTKGGKRPIPLGGKGKGKRSAGKAPKSGNDHKRRHSHKRSQHWDLYIHRALRRFFKRG
TLSKAAVRVLSSFIEDMFNRIQTEAVFVAKINKVKTLTAREIQTSARLLLPPELAKHAMS
EGTKAVAKYNASRGEAYAQGGI
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgcctccgaccaagggtggaaaacgtccgatcccgctagggggtaagggcaagggcaag
cgctcggcgggtaaggcacccaagtcgggcaacgatcacaagcgccgccacagtcacaaa
cgcagtcagcactgggacctgtacatccatcgtgctctccgccgcttctttaagcgcggc
acgctgagcaaggcggccgtgcgtgtgctttcctcctttattgaggacatgttcaaccgc
atccagaccgaggccgtctttgtcgccaagatcaacaaggtcaagactttgactgctcgc
gaaatccagacgtcggcccgtctgctgctgccaccggagctggcgaagcacgccatgagc
gagggcaccaaggctgtcgccaagtacaacgcttcccgcggtgaggcgtatgctcagggc
ggcatttag

DBGET integrated database retrieval system