KEGG   Leishmania major: LMJF_28_0690Help
Entry
LMJF_28_0690      CDS       T01014                                 

Definition
putative serine/threonine protein phosphatase catalytic subunit
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
lma  Leishmania major
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:lma00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    LMJF_28_0690
Enzymes [BR:lma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     LMJF_28_0690
Protein phosphatases and associated proteins [BR:lma01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     LMJF_28_0690
Transcription machinery [BR:lma03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     LMJF_28_0690
Messenger RNA biogenesis [BR:lma03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     LMJF_28_0690
Spliceosome [BR:lma03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    LMJF_28_0690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
28:complement(254990..255895)
Genome map
AA seq 301 aa AA seqDB search
MSVDTIIEQLLEVRGAKPGKQVQLAENDVKQLAIRTREILLSQPPLLELEAPIKICGDIH
GQYYDLIRLFENGGFPPTANYLFLGDYVDRGKQGLETICLVFAFKVKFPENFFILRGNHE
CASINRIYGFFDECKRRYNIRLWKAFTDTFNCLPVACIIDDKIFCCHGGLSPELQTMDQI
KKITRPCDVADTGLICDLLWSDPEEGLSGWGENDRGVSFTFGQDIVEKFLNKHQFELICR
AHQVVEDGYQFFAKRKLITIFSAPNYCNEFDNSGAVMTVDNELMCSFQILKPSVKKPKFY
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcgacaccattatcgagcagctgctggaggtgcgtggcgcgaagccgggcaag
caggtgcagttagccgagaatgacgtgaagcagctggcgatacgcacgcgcgagattctt
ctctcgcagccgcctctgcttgagctggaggcgcccatcaagatctgcggtgacattcac
ggccagtactacgaccttatccgtcttttcgagaacggcggcttcccgcctacagcgaac
tacctcttcctcggcgactacgtggaccgcggaaagcagggtctcgagacgatctgcctg
gtcttcgccttcaaggtgaagttccccgaaaacttcttcatccttcgaggtaaccacgag
tgcgccagcatcaatcgcatctacggcttcttcgacgagtgcaagcgccgctacaacatt
cgcctctggaaggcgttcacagatacgttcaactgccttcctgtggcgtgcattatcgat
gacaagatcttctgctgccatggtggtctttcgccggagctgcaaacgatggaccagatc
aagaagatcacgcgcccgtgcgatgtggcggacactggtctgatctgcgacttgctgtgg
tcagacccggaggaaggactctcggggtggggcgagaacgaccgtggcgtgtccttcact
ttcggtcaggatattgtagagaagttcttgaacaagcaccagtttgagctgatttgccgc
gcgcaccaagtcgtagaggatgggtaccagttcttcgcgaagcgcaagctcatcaccatc
ttctctgcccctaactactgtaatgagttcgataacagcggcgcagtgatgaccgtcgac
aacgagctcatgtgctccttccagatccttaagccgtctgtgaagaagccgaagttctac
tcgtaa

DBGET integrated database retrieval system