KEGG   Leishmania major: LMJF_28_1240Help
Entry
LMJF_28_1240      CDS       T01014                                 

Definition
putative p450 reductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
lma  Leishmania major
Brite
Enzymes [BR:lma01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     LMJF_28_1240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
28:466772..468709
Genome map
AA seq 645 aa AA seqDB search
MSFLYIVATVLFALAGYFYFQLNRQAAGRYGAVSATNNPNGKKAPGVSDAAASGSNAVAK
DQKEVTVLFGSQTGTAEMFAKTLTREGTKLGVPIKVCDLDCYEAYNMEYERLVILICATY
GEGEPTDTMKNFHDWMMDECRSPGEELANVKYAVFGLGDRQYKYFCEEGVVMDRRFEELG
AQRIFGLGCGDSGNGQLEEQFDEWCKDLWPAVGRALNITIKENSEEPVEPQCRVKYWEEA
EEPLAFPKTASVLEPTQRLPVWVPIVRNEELLRNAEGRSSRAIDFSISGTIISYQAGDHL
GILPCNPDELVSQYLQSLGISDEEAGRVFSLQDKKTLKNVLPARVSMRTALKWYIDLTGP
PKKSTLRAFAHCCTDPVQKEELLRILRVNQDAQREFAKLCSKLRTMLGFLRKFNSAKVPL
SFFLELMPRIAPRYYSIASDILATPTLVGTAVGIVDGGLCTNMLARMQVGDTVPVFVRKS
NFHLPMRHKERPVVMIGAGTGVAPFIGFIARRGVWKQKGTELGKSILFFGCRRHDEDHIF
EEYCTEALHEGVLSALVSAYSRDQAQKVYVQHRLRERGAEIWEMLVSGANVYICGDARRM
AKDVEAELKRIVEVEGKMSREAATEYMNAMEKEGRYLKDVWSSAL
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcctctacattgtcgccacggtgctgtttgccctggcgggctatttctacttc
cagctgaaccggcaggctgccggacgctatggcgctgtgtctgccaccaacaatccgaat
ggcaagaaggcgcctggcgtgagcgacgccgctgccagcggcagtaacgcagttgcgaag
gaccagaaggaggtcactgtcctgtttgggtcgcagacgggcacggccgagatgtttgcc
aagacgctgactcgcgagggtacgaagctgggcgtgcctatcaaggtgtgcgacctcgac
tgctacgaggcgtacaacatggagtacgagcgcttggtcattctaatctgcgctacctac
ggcgagggtgaaccgaccgacacaatgaagaacttccatgactggatgatggacgagtgc
cgctcgccaggggaggagctggcgaatgtgaagtacgcggtgttcggcctgggtgatcgc
cagtacaagtacttctgcgaggagggtgtcgtcatggatcgccgcttcgaggaactcggg
gcgcagcgcattttcggcctcggctgcggcgactcgggcaacgggcagctggaggagcag
ttcgatgagtggtgcaaggatctctggcccgctgtcggacgtgcgctgaacatcactatt
aaggagaactcggaagagcccgtggagccacagtgccgagtcaagtactgggaggaggcc
gaggaaccgctcgcgttccccaagacggcttccgtgctggagccgacgcaacgcctgccg
gtgtgggtgcccatcgtccgcaacgaagagctgctgcgcaatgccgagggtcgcagcagc
cgcgccatcgatttcagcatcagcggcaccatcatctcctaccaagccggtgatcacctc
ggcatcctgccgtgcaacccggacgagcttgtctcgcagtacctgcagtccctcggcatc
tccgacgaggaggccggccgcgtcttttccctgcaggacaaaaagaccctcaagaacgtc
ctcccagctcgtgtgtcgatgcgcacggcactcaagtggtacattgacctcaccggaccc
ccgaagaaatcgacgctgcgtgcctttgctcattgctgcaccgaccccgtccagaaagag
gagctgctgcgcattctacgcgtgaaccaggacgcacagagggagttcgcgaagttatgt
agtaagctgcgcaccatgctgggcttcctgcgcaagttcaactctgccaaggtgccgctg
tctttcttcctcgagctcatgccgcgcatcgcgccccgctactactctatcgcttccgat
atccttgccacaccgaccttggtggggacggcggtcggcattgtcgatggtggtctgtgc
acgaacatgctggccaggatgcaggtgggcgacacggtgccggtgtttgtgcgcaagtcc
aacttccacctcccgatgcggcacaaagagcggccggtggtgatgatcggcgccggcacc
ggtgtggcgccattcattggtttcattgcacgccgtggggtctggaagcagaaaggcact
gaactcggcaaatccatcctcttctttggctgccgccggcatgacgaggatcacatcttc
gaggagtactgcacggaggcactccacgaaggggtcctgtcggcgctggtgagcgcgtac
agtcgcgaccaagcccagaaggtgtacgtacagcaccggctgagggagcggggggcggag
atatgggaaatgttggtatctggggcgaacgtctacatctgcggtgacgcgaggcgcatg
gccaaggatgtggaggcggagctcaagcgcattgtggaggtggagggcaagatgtcgcgc
gaggctgctaccgagtacatgaacgcgatggaaaaggaggggcggtacctcaaggatgtg
tggtcatcggccttgtag

DBGET integrated database retrieval system