KEGG   Leishmania major: LMJF_28_2420Help
Entry
LMJF_28_2420      CDS       T01014                                 

Definition
putative 2-oxoglutarate dehydrogenase,E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lma  Leishmania major
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:lma01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:lma00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:lma00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
28:939577..940746
Genome map
AA seq 389 aa AA seqDB search
MFRRVSTRVLPTACSAAHNLNLRFCLSINVPTIAESISTGKVVNWTKKVGDAVAEDEVIC
QIESDKLNVDVRAPANGVITKINFEEGADVEVGAQLSTMKEGPAPAAAAPKAAEVKLDAP
KAEPPKAAAPAASAPAAPAAPAAAAKPAMHTIAGADPRTKSVRISSMRRRIADRLKASQN
TCAMLTTFNEIDMTPLFQLRDKYKDEFHKRHDVKLGLMSPFVKASAIALKDVPIVNASFG
KDTIDYHEFVDIAIAVATPRGLVVPVIRDVQNMNLANIETAIADYAARARINKLTMAEMT
GGTFTISNGGVFGSWMGTPIINPPHSAILGMHAIKKKPWVVGNEIKIRDIMAVALTYDHR
LIDGSDAVTFLVKVKNLIEDPARMVLDLS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgtcgggtgtcgacgcgcgtgttgcccactgcgtgcagtgcggcccacaacttg
aacctccgtttctgcctcagcatcaacgtacccacaatcgccgagtccatcagtacgggt
aaggttgtgaactggacgaagaaggtcggcgacgccgtcgccgaggacgaagtgatttgc
cagatcgagtctgacaagctcaacgtcgacgtgcgtgcgccggcgaacggcgtcattacg
aagatcaatttcgaggagggcgctgatgtcgaggtcggcgcgcaactgtccacaatgaag
gagggccctgcgccagcggcggctgcaccgaaggctgcggaagtcaagttggacgcaccc
aaggcggagccgccgaaggcggccgccccagctgcttcggcgccggccgctcctgccgca
cctgcggcggccgccaagcccgcgatgcacaccatagccggcgctgacccgcgcacaaag
agcgtccgcatctcctcgatgcgccgccgcatcgccgaccgcctcaaggccagccagaac
acgtgcgccatgctgaccaccttcaatgagatcgacatgactccgctgttccagctgcgc
gacaagtacaaggacgagttccacaagcgccatgacgtgaagctgggactgatgtcgccc
ttcgtgaaggcgagcgcgattgcgctcaaggacgtgccaatcgtgaacgcatcctttggc
aaggacactattgactaccacgagttcgtagatatcgcgatcgccgtggcgacgccgcgc
ggccttgttgtgcccgtaatccgtgatgtgcagaacatgaacttggcaaacatcgagacc
gccatcgccgactacgccgcgcgtgcgcgcatcaacaagctgaccatggcggagatgact
ggaggcaccttcaccatctccaacggcggcgtcttcgggtcttggatgggcacgccgatc
atcaacccgccgcatagcgccatccttggcatgcacgccatcaagaagaagccgtgggtg
gtgggtaacgagatcaagatccgcgacatcatggcggtcgctctgacctacgaccaccgc
cttatcgacggtagcgacgcggtgaccttcctcgtgaaggtgaagaatctgatcgaggac
ccggcgcgtatggtgctggacctctcgtag

DBGET integrated database retrieval system