KEGG   Leishmania major: LMJF_30_1200Help
Entry
LMJF_30_1200      CDS       T01014                                 

Definition
putative ubiquitin hydrolase
Orthology
K01072  
ubiquitin thiolesterase [EC:3.1.2.15]
Organism
lma  Leishmania major
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
30:409236..412256
Genome map
AA seq 1006 aa AA seqDB search
MSCYCVEEVDLDIFRGVFIEQWLSGKKHGSCEEALFFCTTCGPPAVQESIKGFSSSVSSS
GANRRSAYTTKTCTPEKKSSSGKFALGSTLKKLFTSSKSSSKADLSTTSSKQHSSCHVRE
LSTRIMSAEEEELPITPRTDKELYLCVTCGSCYCRDHAFDHHYSRQQRSTVAGGDDPDAS
HKGYPYHSFFIGVPSFVSTHPSHILQETSWGLLFPTVTVREIEEGTVDLSKPLPFYEHFE
EICDGGAACEASAFHPNSSATSNSCSFGRGKNTLGFCPSGMHTRIHSAYSSSGHLDGSLR
VYSKSNSYVDKREDRLPTRRSALLSPVGDHGSLSLPEFHSSPPENWSYIMFCARCADRQA
VRLNGKQCDNDISRHVHLRRLGQLTALLAYFLLRGVRLEVPVQFLEYSAKKHAQQVERQR
SQQRAHRLAEMQRVGRASELVGGLEVMATTGARHTSTSGGGVHMSPTGPNVAGDFSLLSR
TETDHVITRAAICGFANESYFCYMNSVLQCLLRCRIFANPLLHLDPSKSPGKLTASVSRL
LHHLAHQTYQDVLNGAVFAFVRSLRTQICNINVLFEEDEQQDAQEFLITLLNGIEDEFDK
GKSEEEKKASRRVSFESTLLSEVTCSQCKHCVPRNEMFMSLSIPIEKSIEDGIASLFAPT
TLRGKDRYACEGCFKKLSQKEQQGHNALAAVQAEAERRAKLDGKKLTQAQIEERVYANAL
YSEAEVRASLSHLGGSLAVHLLRFHYDPTVQDFIKVLTPVRISLTLDLTPYVSGEVVEVY
KHMEKIYLLQRRFPTASEKLICKYLSHANDDVKLATQKMLDDGHGIAEAAHSRQSSSTTV
SRTHTGVGAGNAVGDGASEDAAGFGSVFGDASGCTSGCTSSLAATPLNNLNGDRGTFAKM
AAKSWANTNGSAGKATPSDPAAAICAITSDEFDPFGERTPPKPSLVRQLVGIVAHRGSLH
GGHYIAYVRHLTRPHVWFRCDDEDIDVVEEKHVLDHEAEVYLAFYE
NT seq 3021 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgctactgtgtcgaagaggtcgacctcgacatttttcgtggcgtattcatagag
caatggctcagcggaaagaagcatggcagctgtgaggaggcgctcttcttctgcacaaca
tgcggtccaccagcggtgcaggagtcgataaagggcttctccagtagcgtcagcagcagc
ggcgcgaaccggcgcagcgcctatacaaccaagacctgcaccccagagaaaaagagttca
tccggcaagttcgccttaggcagcacgctgaaaaagctcttcacctcgtccaagagcagc
tcgaaagcggacctgagcaccacttcgtcgaagcagcactctagctgccacgtacgcgag
ctcagcacccgcatcatgtcagcagaggaggaggaactcccaatcacaccgcggacggat
aaggagctgtacctgtgcgtgacctgcggctcgtgctactgccgcgatcacgccttcgac
caccactacagccgtcagcagcgcagcaccgtggcgggcggcgatgaccccgacgcgtcg
cacaagggctacccataccactccttctttatcggcgtccccagcttcgtgagcacccac
ccttcccacatactacaggagacgtcatggggactgcttttccccaccgtgacggtgcgc
gagatcgaggagggcacggtcgacctgtcgaagccgcttcccttctacgagcacttcgag
gaaatctgcgacggcggcgctgcttgcgaggcgagtgcctttcatccgaacagtagcgcg
acctccaacagttgcagctttggccgcggcaagaacacactcggcttttgccccagcggg
atgcacacacgcattcacagcgcctacagcagcagtggccacctcgacgggtccctgcgg
gtctactcaaagtcgaacagctacgtggataaaagggaagaccgcctcccgacgcgccga
tctgccctgctttcccccgtcggggaccacggcagcctctctctgccagagtttcactcc
tcaccgcctgagaactggtcatatatcatgttctgcgccagatgcgctgaccggcaggcg
gtgcgactgaatggcaagcagtgtgacaacgacatctcgcgtcatgtccacctgcgccga
ctgggacagctcacggctctgctcgcgtactttctgcttcgtggtgtgcgcctcgaagtg
cctgtgcagtttttggagtactctgcgaagaagcacgcgcagcaggtggagcggcaacgc
agccagcagcgtgcacacaggttggctgagatgcagcgtgtcggccgcgcctcggagctc
gtcggcggtctcgaagtgatggcgacgacgggcgcgaggcatacaagcaccagcggcggt
ggtgtgcacatgtcgccgacaggcccgaacgtagcgggtgactttagcctactgtcacgc
acagagacagaccacgtcatcacccgtgcggcgatctgcggcttcgccaacgagagctat
ttctgctacatgaactcagtgctgcagtgcttgctgcggtgccgcatctttgcgaacccg
cttctgcacctcgatccgtccaagagccctggaaagctgacggcatccgtgtcgcgtctg
ctgcaccacctggcacaccagacgtatcaggacgtgctcaacggtgccgtcttcgcgttc
gtgcgctcgctgcggacgcagatttgcaacatcaacgtgctcttcgaagaggatgagcag
caggatgcccaagagtttctcatcacgctgctcaacggcatcgaggatgagttcgacaag
ggaaagagcgaggaggagaagaaggcgtcgcgccgtgttagcttcgaaagcacgcttctc
tccgaggtgacttgctcccaatgcaagcactgcgtcccgcgcaacgaaatgttcatgtcc
ctttccatccccatcgagaagagcatcgaggacggtattgcatcgctcttcgcgccgacc
acgctgcgcggcaaggatcgctacgcatgcgagggctgcttcaagaagctgtcgcagaaa
gagcagcaggggcacaacgccctcgccgcagttcaggccgaggcagagaggagggccaag
ttggatgggaagaagctcactcaagcgcagatagaggagcgtgtgtatgccaacgctctc
tacagcgaggccgaggtacgcgcctcgctctcccacctcggcggcagccttgcggtgcat
ctcctgcgcttccactacgacccgacggtgcaggacttcatcaaggtactcacaccggtg
cgcatctcgctcacccttgacctcaccccgtacgtcagcggcgaggtggtggaggtctac
aagcatatggagaagatctacctcttgcagcgccgcttcccgactgcgtcagagaagctg
atttgcaagtacctaagccacgccaacgatgatgtcaagctggccacgcagaagatgttg
gatgacggtcatgggatagccgaggcggcgcactcacggcagagtagcagcactaccgtc
agccgcacccacactggggtgggggcaggcaacgcggtaggcgatggcgcatctgaggat
gcggctggcttcggcagcgtctttggcgacgcctctggctgcacctccggctgcacctct
tccttggctgcgacgccgctcaacaacctcaatggggatcgcggtacctttgccaagatg
gcggccaagtcttgggcaaacactaacggaagcgctggcaaggctacaccgtctgatccc
gctgctgcgatttgtgcgattacgagcgatgaattcgatccgtttggcgagcgcacccct
ccgaagccatcgttggtgcgtcagctggtgggcatcgttgcgcatcgaggctcgctgcac
gggggccactacatcgcctatgtgcgccacctcactcgcccacatgtatggttccgctgc
gacgacgaggacatcgatgtggtggaggagaagcacgtgctggatcacgaggctgaggtg
tacctcgccttctacgagtag

DBGET integrated database retrieval system