KEGG   Leishmania major: LMJF_31_0140Help
Entry
LMJF_31_0140      CDS       T01014                                 

Definition
putative ubiquitin hydrolase
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
lma  Leishmania major
Brite
Enzymes [BR:lma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     LMJF_31_0140
Peptidases [BR:lma01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   LMJF_31_0140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
31:complement(36206..37579)
Genome map
AA seq 457 aa AA seqDB search
MAKIKVKWGKENLTMEVDLGSTVGAFKEALKAETGVPVEKQKLMGLKPSMNKDDATLSAA
GLVTGKTVMLIGSAESTATVPTVQAAVVEANETGGYTATAPTSNGLKNIANTCYLNSALQ
MMRSIPEIREVLDVYRGDNALLQQLGAVLQLLESTKDAVMPLQFWTTLVQTNPTFGERNE
HGGFIQQDSQEVLNMLLQAVNAVLPEKYAHLFEGKLHQTLTCVDDPADKGKESDVPFTML
SCNITGEVQTLEAGLEHAFDEHFTAPCEALQKDAARFTRVSRLTEAPEYVFVHMVRFSWR
GDIQKKAKILKPITFPFILDTTIISTEALKAAQKPVREDIRERRDTELARRCRPRAEEKP
SPVDKPEEEKVPLILRNESGYYDLCGVISHKGRSADGGHYVYWGKKADTWLVYDDEHVAA
VSEEDVKRLRGVGEAHIAYVLLYRSRDPVTRTPVIPL
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaatcaaagtcaagtggggtaaggagaacctcacgatggaggtggacctgggc
agtacggtgggtgccttcaaggaggcgctcaaagccgagaccggggtgccagtggagaag
cagaagctcatgggcctaaagccctccatgaacaaggatgacgccacgctcagcgccgcc
ggcctcgtgactggcaagacggtcatgctgattgggtcagcggagagcactgcaacggtg
cccacagtgcaagcggctgttgtagaagcgaatgagacaggtggctacaccgcgactgcg
ccaacctcaaatggcttgaagaatatcgccaacacgtgctacctgaactcggctctgcag
atgatgcggagtattccggagattcgggaagtgctcgacgtgtaccgcggcgacaacgca
cttctgcagcagctcggtgctgtgctacagttgctggagagcaccaaggatgcggtgatg
ccgctgcagttctggacgacgctcgtgcagacaaacccaacgtttggcgagcgcaacgag
cacggtggcttcatacagcaggactcgcaggaggtgctgaacatgctgctccaggccgta
aacgccgtgctgcccgagaagtacgcgcacctctttgaaggcaagctgcaccagaccctc
acctgcgtcgacgaccccgctgacaagggcaaggagtccgacgtgcccttcacgatgctc
tcctgcaacatcaccggcgaggtgcaaacgcttgaggcggggctcgagcacgccttcgac
gagcacttcaccgcaccttgcgaggccctgcagaaagacgccgcccggttcactcgcgtt
agcagactgaccgaagcaccggagtatgtctttgtgcacatggtgcgcttctcctggcgc
ggcgacattcagaagaaggcgaagatcctcaagcctatcacgttccccttcatcctcgac
accaccatcatctccaccgaagcgctcaaggcggcacagaagccggtgcgcgaggatatc
cgcgagcggcgcgacacggagctggcgcggcgttgccgcccccgcgcagaggagaagccg
tcgccagtggacaaaccggaggaggagaaggttcccctgatcctcaggaatgagagcggc
tactatgacctgtgcggcgtcatctcgcacaagggccgcagcgcggacggcggccactac
gtctactggggtaagaaagcagacacgtggctcgtctacgacgacgagcacgtggcggcc
gtctcggaggaggacgtgaagcggctgcgtggtgtcggagaagctcacatcgcctacgtc
ctgctgtatcgcagtcgcgaccccgtcacacgaactccggttattccactttag

DBGET integrated database retrieval system