KEGG   Leishmania major: LMJF_32_0520Help
Entry
LMJF_32_0520      CDS       T01014                                 

Definition
putative profilin
Orthology
K05759  
profilin
Organism
lma  Leishmania major
Brite
Exosome [BR:lma04147]
 Exosomal proteins
  Proteins found in most exosomes
   LMJF_32_0520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
32:188195..188647
Genome map
AA seq 150 aa AA seqDB search
MSWQAYVDDSLIGSGNMHSAAIIGAADGSYWAYGGSYVPQPEEVQHIQKCLSDFSFVQSS
GVNIYGVKFFGLQCGTDGDCKYIFFKKGAAGGCIYTTKQAFIVAVYGNPGDTSSLQQDLE
KNTAHAVTVNPADCNTTVKRIADYLIKLGY
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcaggcatacgttgatgacagccttatcggcagcggcaacatgcacagcgct
gctattatcggagccgctgacggcagctactgggcgtacggcggtagctacgttccgcag
ccggaagaggtgcagcacatccagaagtgcttgtccgatttctcgttcgtgcagtcctct
ggtgtgaacatttacggtgtcaagttcttcggcctccagtgcggcaccgacggtgactgc
aagtacatcttcttcaagaagggtgcagccggcgggtgcatttacaccacaaagcaggca
ttcatcgttgccgtatatgggaaccccggtgatacctcctcgcttcagcaggatcttgag
aagaacacagctcacgcggtcaccgtgaaccctgcggactgcaacactacagtgaaacgc
atagcggattatctcatcaagctcggctactaa

DBGET integrated database retrieval system