KEGG   Leishmania major: LMJF_32_1250Help
Entry
LMJF_32_1250      CDS       T01014                                 

Definition
putative ubiquitin hydrolase
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
lma  Leishmania major
Brite
Enzymes [BR:lma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     LMJF_32_1250
Peptidases [BR:lma01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   LMJF_32_1250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
32:483835..485064
Genome map
AA seq 409 aa AA seqDB search
MNNSNFCFMNSMLQALMFIPSFAQLTVSVSCDAQARQLCPTLVTLGKWTLQYWKPGFTRL
AMIAPTLMPRVPAGANNSNSGAPRSAVVPASQRILDGSVQEDAQEFLQKLLERVHEELVG
LEEAFQQADASEAATESEMGSIGPAATASTASGGGRTDAPDDATTSTFPKKGWTFVKGKE
KLAVREHEDTRGQSKLLSSIFGGTLESHLQGKQRQRNRVSVLIERYYCLPVDVGFAPECT
VEQALERTFMTERIYDSEHEKNLKKTLRLGHLPSILFLQLRRWAVTREGELVKLDNVVRV
TRTLLIPRTICADDTLGNTERMYRLLSVVCHRGDAVSRGHYVTYLMHHAATPAALKVQAS
EPGNKDTAILRSPPGAATVILCNDANISVCPAKNMEKETVYFLVYQKTS
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaataacagcaacttctgcttcatgaattcgatgctgcaggcactcatgttcataccc
tcctttgcgcaactgaccgtctccgtcagctgtgatgcgcaggcacgccagctgtgcccg
accctggtgacccttggaaagtggacacttcagtactggaagcccggtttcacgcggcta
gcgatgatagccccaacgttgatgccacgcgtgcctgctggcgccaacaacagtaacagc
ggcgctcctcggtcggccgtggtgcccgcctcgcagcggatccttgacggctctgtgcag
gaggatgcgcaggagtttctgcagaagttgctggagcgtgtgcatgaagagctggtgggt
ctcgaggaagcgtttcagcaggccgacgcctctgaagcggctacggagagtgaaatgggg
tcgattggccctgctgccacggcgagcaccgccagtggtggtggccgcaccgatgctccg
gacgacgccaccacctcgacctttcccaagaagggctggacctttgtgaagggaaaggag
aaactggcggtgcgggagcacgaggatacgcgagggcagtcaaaactgctctcaagtatc
tttggcggaacgctggagagccacttgcaagggaagcagcgccagcgaaaccgcgtgtca
gtgctcatcgagaggtactactgtctccccgtcgacgttggctttgcgccggagtgtact
gttgagcaagctctcgagcgcaccttcatgacagagcgcatttatgacagcgagcacgag
aaaaacctcaagaagacgctccgcctcggccatctaccctccattctttttctgcagctg
cgccgctgggccgtgacgcgcgagggcgagctcgtgaagctcgacaatgttgtgcgtgtc
acgcgcaccttgctgattcctcgtactatctgcgctgatgatacacttggcaacaccgag
cgaatgtaccgtctcctgtcggttgtgtgccaccgcggtgacgccgttagtcgggggcac
tatgtcacctacttgatgcaccacgctgcgaccccagctgccctgaaggtgcaggcgagt
gagccgggaaacaaggatactgcaatcctgcgctcgccgcctggcgcggcgacagtgatt
ctctgcaatgacgccaacatttccgtgtgtccagcaaagaacatggagaaggagaccgtg
tactttctcgtctaccagaagacaagctga

DBGET integrated database retrieval system