KEGG   Leishmania major: LMJF_32_2910Help
Entry
LMJF_32_2910      CDS       T01014                                 

Definition
putative ubiquitin hydrolase
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
lma  Leishmania major
Brite
Enzymes [BR:lma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     LMJF_32_2910
Peptidases [BR:lma01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   LMJF_32_2910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
32:complement(1147605..1151630)
Genome map
AA seq 1341 aa AA seqDB search
MSSEGVLSSGDAMEEMELKERNHSIEGSSFTATTRDSFASAEEDSTASQVNEEACMATGK
PRTVAWNGTSTAAHDYIAASTAATDGEENAAVGAQPQPPLDRLQAYIQALVGNILESLRG
FDGSIAWLKRSHSAIAAHLDGINAGAVPAATEEFSVAWFGIASAVLHDLIQESVADISAL
ATPPLPFSENEESARGLCVTPRDLSVAFVSGLQSIVSEVMNNGGCHRSGGSHHFSRYSLR
SFAHVKEISEMSRRLMEEHLTQGAHVPHALRNKYSDDTTSIDCKEDLCSILQRTADAWVC
SFFPAYQQRSRNPTEVAPFLWGEEEDASRLNLELFFYCLYFACQQRSLMQNREALPRGVV
VPTAWIEQLLRWSAQAKEQHCLASPGPHPPFPGPIDTFALMTVSPHDPRRHWLSLDSERY
QVIPQALYNSFFDFFGTGPKYVMYGAFSLRERCLLMWKPLPLTVFTTFEWWERNESDGAL
DKYSVEVPVEEALLHSDMREVCHLAWGMMREEEGMMSEKVARVWFAAINGTDTVRICCKG
LYMLSVKTGPFAITEKGDGMDLTVQEILQQLRRRIEQYMPESVEEWRLQTSGKVLLSLVL
TLNNTNGDDRGGEITGTMEVAAHQCGVCGLTNVGNTCYMNSALQCLSNLTSFRTKLLTLP
ISHFSQAVITLLLIRLLTTMWSGQHSFAETRELKEQIGMQVKRFSGYQQQDANEFIEVLL
DHLSEECNLISERCYRQREDSDKAIATQELSTIFWSNFLENNKSFIPPLFFHQSKTVFTC
LTCGECSTVFDNNVTLSVSIKDPPQRRAMSVDVMVELNKPDYAAELASHSGFMAPLFRPV
KGGAARAHALVTLKVHLLVQPDNTVREQEVEEALRQLLLSNASSSSEVLRFFLDGSADEM
TAEEERQRARSVAARVQVDVRVMDIPDHGRVLAWARCYLASAELSVASAPPPTTVGAAGT
PAARVWYFMKDAPLPFTTAIMGTPVWVDEFPASYGAEHPQPVAADAADAEELVLASESRD
CMTAYAEHIRTRSLEVATALLQRVPEDETDEVALFNSTETLSGGVGYVMPPSHKDEAKET
LASANDAGAAAASIERDIKIVQRILRKSASATVTKTTSPGGDINADATGSEACEKALASA
AVTTTIVVCIQYDSAKYQLVTDGRRSDAFGLRGVGSDMTPEVKCSLHECLSHSMQPDLLR
GEDAWFCRRCKEFRETKVHRTLFRLPPCLIVSFKRFKMHTYSADKKNTTVQFPSELDFAP
YLDPEAAGLQTEGTKYRLRGVVYHTGSLSFGHYTAAAFNDSVKKWVYYNDTHATIDSCDA
PAPNGAYILCFERVEATASPA
NT seq 4026 nt NT seq  +upstreamnt  +downstreamnt
atgagctctgaaggtgttctgagctctggggacgctatggaggagatggagctgaaggag
agaaaccacagcattgaaggatcttcgtttaccgccactacccgtgacagcttcgcctct
gcagaagaagactcgacagcgtcacaggtcaacgaagaagcgtgcatggctaccggcaag
ccgagaaccgtagcttggaatggcacgtctacggcagcgcatgactacatcgctgcttct
acggctgcaacggacggcgaggagaatgctgccgtgggggcgcagccgcagcctccgctc
gatcgactccaggcttatattcaggcgcttgtgggcaacatcttggagagccttcgtggg
ttcgacggcagcatcgcatggctaaagcgctcacactcggcgatcgcagcccacctggac
ggcatcaacgccggggctgttccggccgcaacggaggagtttagcgttgcctggttcggt
atcgcaagcgctgtgctgcatgacttgatccaagaaagcgtagcggacatttccgctctc
gcgacgccgccgcttccgttcagcgagaatgaggaatcagcgcgtgggttgtgcgtgacg
ccgcgcgatctgtccgttgcctttgtctcgggtttgcagagcattgtttcggaggtgatg
aataacggcgggtgccatcgctcgggtggcagccaccacttcagccgctactccttgcgc
agttttgcccatgtaaaggagatcagcgagatgagccgccgtctcatggaggaacacttg
acgcagggagcacacgtgccgcacgcgctgcgcaacaagtacagcgacgatacgacctca
atcgactgcaaggaggacctctgctccattctccagaggactgctgatgcgtgggtgtgc
agcttcttcccagcctaccagcagcgctctcgcaacccgacagaggtggcgccgtttctg
tggggagaggaagaggacgcctcgcgcctcaacctggagctgttcttttactgcttgtac
tttgcttgtcagcagcggagcttgatgcagaacagggaggctcttccgcgcggcgttgtg
gtgccgacggcgtggatcgagcagctgctgaggtggtccgcgcaagcgaaggagcagcac
tgcttggcctcacccgggccacacccaccttttccgggcccgatcgacacgttcgcgctc
atgacagtctcgccgcacgacccgcgccggcactggctttctctagactcggagcgatac
caggtgattccacaggctctgtacaactccttctttgacttctttggcaccggccccaag
tacgtcatgtatggcgccttctctctgcgggagcgctgtcttctcatgtggaagccgctt
ccgctgaccgtgttcacgacatttgagtggtgggagcggaacgaatcggacggagcgctt
gacaagtacagcgtagaggtacctgtggaggaggcactcctgcatagcgacatgcgcgag
gtgtgccacctcgcctggggtatgatgagggaggaggagggcatgatgtcggagaaggtg
gccagggtgtggtttgcggcaatcaacggaaccgacacggtgcgcatctgctgcaaaggc
ctctacatgctttccgtgaaaacagggccattcgcgattacagaaaagggggatgggatg
gacctgaccgttcaggagatattgcagcagctgcggcggcgcatcgagcagtatatgccg
gagagcgtggaggagtggaggctgcagacgagcgggaaggtgctcttgtccctggtgctg
acgctgaacaacacaaacggcgacgaccgtggaggcgaaattacaggcacaatggaggtg
gcggcacaccaatgcggtgtgtgcggcctgaccaatgtcggcaacacgtgctacatgaac
agtgcccttcagtgcttgtcgaatctcacctccttccgcacgaagcttttgacgcttccc
atttcgcacttttcacaggcggtgataactctgctactcattaggttgctgacaacgatg
tggtctgggcagcactccttcgcagagacccgtgaacttaaggagcagattggtatgcaa
gtgaagcggttttctggctaccagcagcaagatgcgaatgagttcatagaagttctcctg
gatcacctgagtgaggagtgcaatctcatctcggagcgatgctaccgacagcgcgaggac
agcgacaaggcgatcgcgacgcaggagctctccaccatcttctggagcaacttcttggaa
aacaacaagtcgttcataccacccctcttcttccaccagtcgaagaccgtcttcacatgc
ctcacgtgcggggaatgcagcaccgtcttcgacaacaacgtcacgctctccgtcagcatc
aaagacccgccgcagcggcgcgccatgagcgtggatgttatggtggagctaaacaagcct
gactacgcggcggagctcgcatcacacagcggcttcatggcaccgctatttcgacctgtg
aaggggggcgcggcccgtgcgcacgcgctggtgacgctgaaggttcacttgctggtgcag
ccagacaacacggtgcgcgagcaggaggtggaggaggcgcttcggcagctgctgctgagc
aatgccagttctagcagcgaggtgctgcgtttttttctggacggctctgcagatgagatg
actgcggaggaggagaggcagagggcaaggagtgtggcagcgcgtgtgcaggtggacgtg
cgcgtaatggacattcctgatcatggccgcgtgcttgcttgggcacggtgctacctggcg
agcgcagagctgagcgtggcatctgcgccgccaccgactacggtgggcgcagcagggacg
cctgcggcacgtgtgtggtacttcatgaaggacgccccgcttcccttcacgactgccata
atgggcaccccggtttgggtcgacgagtttccggcgtcttacggtgcggagcacccgcag
ccagtggccgcagatgccgccgacgcggaggagctcgttttggccagcgaatcccgtgat
tgcatgaccgcctacgcggagcacatccgcacgcgctctttagaggtggcgacagcactt
ctgcaacgcgttccagaggacgagacggacgaagtagcgctcttcaattccacagagact
ctaagtggaggggtagggtacgtcatgcctccatcccacaaggacgaagccaaagaaacg
ctggcgtctgcaaacgacgccggcgcagcggctgcatccattgagcgggacatcaagata
gttcagcgcattctccgcaaatccgcatccgccaccgtcacaaaaaccacatccccggga
ggcgacatcaacgcagacgcgacagggagcgaggcctgtgaaaaggcgctagcttccgcg
gcggtgacgaccaccattgtcgtgtgcatccagtacgactctgccaagtatcagctcgtc
accgacggacggaggtcggacgccttcggactccgcggcgtaggtagtgacatgacaccg
gaggtgaaatgctcgctgcacgagtgcttgtcgcactctatgcagccggacctgctgcgg
ggcgaggatgcgtggttctgccgtcgctgcaaggaattccgggagacgaaggtgcaccgc
accctcttccgtctgcccccgtgcctcattgtgtcctttaagcgctttaagatgcacacg
tacagtgctgacaagaagaacactacagtgcagttccccagcgagctcgactttgcgccg
tacctggacccagaggccgctggacttcagacggaggggacgaagtaccgcctgcgcggt
gtggtgtaccacaccgggtcgctcagctttgggcattacactgcggccgccttcaacgat
tccgtgaagaaatgggtatactacaacgacacacacgcgacgatcgacagctgcgacgcc
ccagcgccgaatggggcgtacattttgtgttttgagcgcgttgaggctacggcaagccca
gcgtaa

DBGET integrated database retrieval system