KEGG   Leishmania major: LMJF_32_3680Help
Entry
LMJF_32_3680      CDS       T01014                                 

Definition
putative 3-hydroxyisobutyryl-coenzyme A hydrolase
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
lma  Leishmania major
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LMJF_32_3680
  Carbohydrate metabolism
   00640 Propanoate metabolism
    LMJF_32_3680
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LMJF_32_3680
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LMJF_32_3680
Enzymes [BR:lma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     LMJF_32_3680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
32:1499257..1500372
Genome map
AA seq 371 aa AA seqDB search
MHRTGARCSASVLYKDYPHARHITLNRPNSLNALDYGMTRELHRLYVTEPAPPPSLYILT
GAGTKAFCAGGDVIGLTTNNPPGCGREFFYWEYQVDYKASIIPAGQVCLWDGYVLGGGAG
LSIGSAYRVASEKACFAMPEVAIGMFPDVGASWFLPRLSVPGLGLYMGLTGHRLRGADLV
HLGLATHFVPSAKMGELEQALVSMSDAGDVEAVLDKYTTPTTQLPPCTIAHSISSLASHF
DITADLTISSILDACREHAQTDPLAKAAADLMPSFSPTAMTLALELLKRGAKLSTPVEAF
QMEYCVSQRIIAEHDFREGVRALLIDKDKKPKWQPSTVAEVSAEAIDAYFRPTTPDQPVW
DPVAPLSERAS
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgcatcggaccggcgcgcgttgtagcgcgagcgtgctctacaaagactacccgcatgcg
cgccacatcaccctcaaccgacccaattcactgaacgcgctggattatggcatgacacga
gagctgcaccgtctgtacgtgacagagccagctcctccgccatccctgtatattctcacc
ggggcaggcacaaaggcgttctgcgccggcggcgatgtgatcggcctcacgacgaacaac
ccgcccggatgcggtcgtgaattcttctactgggagtaccaagtcgactacaaggcgagc
atcattcctgctgggcaggtgtgcttgtgggacggctacgtgctcggcggcggcgctggc
ttatcgattggaagcgcttatcgggtggcgtcggagaaggcatgctttgcaatgccggag
gtggccataggcatgttccccgacgtaggggcttcgtggttcctgccgcggctgtcggtg
cctggactggggctctacatggggctcaccggccaccggctccgcggggcagaccttgtg
caccttggacttgcaacacactttgtgccatctgccaagatgggcgagctggagcaggct
cttgtctcgatgtcggatgcaggtgatgtggaggcggtgctggacaagtacacgacgccg
acaacgcagctgccaccatgcaccatcgcccattccatttcttctctcgccagtcatttt
gacatcacggcagatctaaccatatcgtccatcttggacgcgtgcagggagcatgcgcag
acggatccgctggccaaggcagcggcggacctcatgccttccttctctccgacggcaatg
acgctcgcactggagctgctgaagcgcggcgcgaagctgagcacaccagtggaggcgttc
cagatggagtactgcgtttcccagcgcatcatcgcggaacacgactttcgcgaaggtgtc
cgagccctgctcattgataaagacaagaagccgaaatggcaaccgtcaactgttgccgag
gtttcggcggaggccatcgatgcatacttccgccccaccacaccggaccagccggtctgg
gatccagtggcgccgctctcagagcgcgcatcgtga

DBGET integrated database retrieval system