KEGG   Leishmania major: LMJF_33_1090Help
Entry
LMJF_33_1090      CDS       T01014                                 

Definition
putative guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lma  Leishmania major
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lma00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LMJF_33_1090
Enzymes [BR:lma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LMJF_33_1090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
33:506559..507170
Genome map
AA seq 203 aa AA seqDB search
MSKPLNALVVCGPSGVGKGTLLGRLLREYPNRFAYSVSHTTRQPRQGEVNGREYHFTDRE
SILKMRDNNEFLELCDVHGNFYGTSVAAVHAVQKEGKVCVIEIDVKGAQKLFSRTDNALN
AVYFFITAPREELRKRIMKRGADDETMLQRRLETAESEYKFVDENPDFFSVLLVNDELEA
AYAGLLAAIDDQLVKHNMEKLAA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagccgttgaacgcgctggtggtctgtggtccctctggggtaggcaagggaacc
ctgctgggccgcctcctccgcgagtaccccaaccgcttcgcctactcggtgtcgcacaca
acacgtcaaccgcgccagggagaggtgaatgggcgcgagtaccactttaccgaccgtgag
agcatcctcaagatgcgcgacaataacgagttcctcgagctgtgcgacgtgcacggcaac
ttctacggcacgagcgttgccgccgtgcacgctgtgcagaaggaagggaaggtgtgcgtc
atcgagatcgatgtaaagggggcacagaaactgttcagccgtaccgataatgcgctgaac
gccgtgtacttctttatcacggcccccagagaggagctgcgcaagcgtatcatgaagcgt
ggcgccgatgacgaaacaatgctgcagcggcgtctagagacagccgagtcagagtacaag
ttcgtcgatgaaaatcccgacttcttctctgtgctgctggtgaatgatgagctagaggca
gcgtacgctggcctcttggccgccatcgacgaccagctggtgaagcacaacatggagaag
ctggctgcctag

DBGET integrated database retrieval system