KEGG   Leishmania major: LMJF_34_2670Help
Entry
LMJF_34_2670      CDS       T01014                                 

Definition
NADPH-cytochrome p450 reductase-like protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
lma  Leishmania major
Brite
Enzymes [BR:lma01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     LMJF_34_2670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
34:1224464..1226338
Genome map
AA seq 624 aa AA seqDB search
MTGLTILYGTQTGNAERLALRIARLALCQGFERVSCLPADDLPIAEWPHTGGPVVLICSN
ANQGDAPNTLRRSWASLLQPTAAGSMEGLQYAVFGLGDSLYLKFNHMAKMVHNRLRQLGG
TPIVMRGLGDESDAKGVEEALQPWLAELWTALEKPGKCGAAARTPAYPQEDLPFFPLFSI
ASASACDEATPGTPSSSANAAVVPLPYFDDSVFSCEVVANRRLTSAACEQVVHHLELRAG
PDSTDAAAYEVGDALGIYCPNREELVERLLRRLQRDGAEMVVVTPDSSHGLVRQPTRPFF
GRPLSLHSLLRHYFDLDAVVSQEFLWMLAHGVTGEDEVAVDVRERLYELADPSNVNDYLQ
YAHREKRNLCEVLHDFKDLHPSLELVLSFATPMLPRYFSIASAPAMDGAGRFDLCVGLLD
WHTPLKRHRTGLCSSYLVGAAPGTRLTCFVWQGSLALPATPTPLLCIATGTGVAPIRSVL
RQVAGLSTQGWADVPVVLVFGCRRETEDYLYREEWATLKEMGALPTLRVIPAFSRDTDKK
VYVQHKLGQHARLTSSFLQPEGAGVPPGVVYVCGNAKQMPKDVQHTLEQIVEATVAGVQD
EAGAAAHIRALGRVGRYQVDSWSA
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgacaggccttacaattctgtacgggacgcagactggcaacgcggagcggctagcgctg
cgcatcgctcgactggcactttgccaggggttcgagcgcgtctcgtgcctgccagccgat
gacctgcctatcgccgagtggccgcacaccggagggcctgtcgttcttatctgctccaac
gcgaatcaaggagatgccccgaacacgcttcgccggtcgtgggcgtcgttgctacaaccc
accgccgctggcagcatggagggtctgcagtacgctgtcttcggcttgggcgactcgctg
tacctcaagttcaaccacatggccaagatggtgcacaaccgtctccggcagctgggcggc
acaccgattgtgatgcgcgggctgggagatgagagcgatgcgaagggtgtggaggaggca
ttgcagccctggctcgcggagctgtggacagcacttgagaaaccgggcaagtgcggtgcc
gccgcacgcacgccggcttacccgcaggaggaccttcctttctttcctcttttcagtatt
gcctccgcctctgcgtgcgacgaggcgacacctggcacgccgtcttcttccgctaacgcc
gccgtcgtgccactcccgtattttgacgactctgtgttctcctgcgaggtggtggcgaac
aggcgcctcacatctgctgcgtgcgagcaggtggtccaccacctggagcttcgtgcgggt
cctgacagcacggacgccgcggcgtacgaagtcggcgatgcgctcggcatttactgcccg
aatcgcgaagagctagtagagaggctgctgcgcagactgcagcgagacggggcagagatg
gtggtggtgaccccagactcctcgcatggactcgtccgtcagcccacccgccccttcttt
gggcggcctctttctctacattcgttgcttcgtcactactttgaccttgacgccgtggtg
tcgcaggagttcttgtggatgctcgcgcatggggtgactggggaggacgaggtcgcggtc
gacgtgcgggaacgcctctacgagctggcagatccgtccaacgtgaacgattaccttcag
tatgcgcaccgtgagaaacgcaacctatgcgaggtcctgcacgacttcaaggaccttcat
ccatctctggagttggtcttgtcgtttgcgacgccgatgctaccgcgctacttctccatc
gcctccgcgccagcaatggacggcgcaggtcgttttgacctctgcgtagggctgctggac
tggcacacgccactgaagcgccaccgcaccgggctctgcagctcctacctcgtgggggcg
gcccccgggacacggctgacgtgttttgtctggcagggctcccttgcacttcctgctaca
ccgactccgctgctgtgcatcgcgacggggacgggcgttgcaccaattcgcagtgttctg
cggcaggtcgcaggtctttccacgcagggctgggctgacgtgccggtggtgcttgtattt
ggatgccgacgtgagacggaggattacctgtaccgcgaggagtgggcgacgctgaaggag
atgggcgcactgcccaccctccgagttatcccggccttctcgcgagacaccgacaagaag
gtttacgtgcagcacaagctcggccagcacgcaaggctgacgtcgtcctttttgcagccc
gagggcgccggtgtcccgcctggcgtggtgtacgtctgtggaaacgcgaagcagatgccg
aaggacgtgcagcacaccctagagcagattgtcgaggcgaccgtggcgggggtgcaggac
gaagccggggcggccgcgcacatcagggcccttggccgcgtgggtcgctatcaggtggac
tcgtggtcggcgtag

DBGET integrated database retrieval system