KEGG   Leishmania major: LMJF_34_3380Help
Entry
LMJF_34_3380      CDS       T01014                                 

Definition
aldose 1-epimerase-like protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
lma  Leishmania major
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMJF_34_3380
Enzymes [BR:lma01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     LMJF_34_3380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
34:1481569..1482474
Genome map
AA seq 301 aa AA seqDB search
MVTFTPDSRGRNCVTIHSEDGSSITVYEQGAHVSSWKTKDGKEHLYLSPTAIFADRTALR
GGVPLIFPQFGAYGPLQPSHGFARIRSWNMEDAQSGRASFSLRVPLCELLPKDSSLTDSP
QNAVNLLYTICFSNTELKLRMKVTNTSEEQSAPFQFAFHTYFAVSDVSRTVVSGVNRSPF
VDNCKARGNPDAPPSPPEQLWIIRGEHDRVYPDQACAIVLQDMGAKTTLQISSPNLSDVC
LWNPGESKCAAMKDMPPDGYKHFVCVEHGKMLKKVVVPPCSSWTGTQEIAIIAESPHESS
I
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggttaccttcactcccgactcccgcgggcgcaactgcgtcaccatccacagcgaagac
ggctctagcattaccgtctacgagcaaggcgcgcacgtcagcagctggaagaccaaggat
ggaaaagagcatctgtacctcagccccaccgccatctttgctgaccgtaccgccctgcgt
ggtggcgtgccgctgatcttcccgcagttcggggcttacggcccactgcagccgtcgcac
ggcttcgcgcgcattcgttcgtggaacatggaggatgcccagagcggcagggcgagcttt
tcgttgcgcgtgccgctgtgcgaactgctgccgaaagattcttctctcacagattccccg
cagaacgcggtcaacctgctgtacacgatttgcttcagcaacaccgagctgaagctgcgt
atgaaggtcacgaacacgagcgaggagcagtcagcaccgtttcagttcgccttccacacg
tatttcgcagtgtccgacgtttcgcgcacggtggtcagcggcgtcaatcgctctcctttc
gtcgacaactgcaaggcgcgcggcaacccggacgcaccgccgagcccgccggagcaactg
tggattattcgcggcgagcacgaccgcgtttaccccgaccaagcgtgcgccatcgtcctc
caggacatgggtgcgaagaccacgcttcaaatctccagtcctaacctaagcgacgtgtgc
ctctggaaccctggcgagtccaagtgcgctgcgatgaaggacatgccaccggatggctac
aagcattttgtgtgtgtggagcacggaaaaatgctgaaaaaggtggtggtgccgccgtgc
tcgagctggactggcacgcaggagatcgcaatcatagctgaaagccctcatgagtcgagc
atatag

DBGET integrated database retrieval system