KEGG   Leishmania major: LMJF_34_3380Help
Entry
LMJF_34_3380      CDS       T01014                                 

Definition
aldose 1-epimerase-like protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
lma  Leishmania major
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lma00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
34:1481569..1482474
Genome map
AA seq 301 aa AA seqDB search
MVTFTPDSRGRNCVTIHSEDGSSITVYEQGAHVSSWKTKDGKEHLYLSPTAIFADRTALR
GGVPLIFPQFGAYGPLQPSHGFARIRSWNMEDAQSGRASFSLRVPLCELLPKDSSLTDSP
QNAVNLLYTICFSNTELKLRMKVTNTSEEQSAPFQFAFHTYFAVSDVSRTVVSGVNRSPF
VDNCKARGNPDAPPSPPEQLWIIRGEHDRVYPDQACAIVLQDMGAKTTLQISSPNLSDVC
LWNPGESKCAAMKDMPPDGYKHFVCVEHGKMLKKVVVPPCSSWTGTQEIAIIAESPHESS
I
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggttaccttcactcccgactcccgcgggcgcaactgcgtcaccatccacagcgaagac
ggctctagcattaccgtctacgagcaaggcgcgcacgtcagcagctggaagaccaaggat
ggaaaagagcatctgtacctcagccccaccgccatctttgctgaccgtaccgccctgcgt
ggtggcgtgccgctgatcttcccgcagttcggggcttacggcccactgcagccgtcgcac
ggcttcgcgcgcattcgttcgtggaacatggaggatgcccagagcggcagggcgagcttt
tcgttgcgcgtgccgctgtgcgaactgctgccgaaagattcttctctcacagattccccg
cagaacgcggtcaacctgctgtacacgatttgcttcagcaacaccgagctgaagctgcgt
atgaaggtcacgaacacgagcgaggagcagtcagcaccgtttcagttcgccttccacacg
tatttcgcagtgtccgacgtttcgcgcacggtggtcagcggcgtcaatcgctctcctttc
gtcgacaactgcaaggcgcgcggcaacccggacgcaccgccgagcccgccggagcaactg
tggattattcgcggcgagcacgaccgcgtttaccccgaccaagcgtgcgccatcgtcctc
caggacatgggtgcgaagaccacgcttcaaatctccagtcctaacctaagcgacgtgtgc
ctctggaaccctggcgagtccaagtgcgctgcgatgaaggacatgccaccggatggctac
aagcattttgtgtgtgtggagcacggaaaaatgctgaaaaaggtggtggtgccgccgtgc
tcgagctggactggcacgcaggagatcgcaatcatagctgaaagccctcatgagtcgagc
atatag

DBGET integrated database retrieval system