KEGG   Leishmania major: LMJF_34_4060Help
Entry
LMJF_34_4060      CDS       T01014                                 

Definition
putative ubiquitin hydrolase
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
lma  Leishmania major
Brite
Enzymes [BR:lma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     LMJF_34_4060
Peptidases [BR:lma01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   LMJF_34_4060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
34:1728410..1731130
Genome map
AA seq 906 aa AA seqDB search
MRSGYVGIYNQGSTCYLNSVIQALYHLPAFRTQIYNLPNVEKDSVALALRDVFAQLEVRN
RNTTTTELTKAFGWSAQEAAVQHDVHELMQQLFDSLETTLKETSKKNMIRDMFGGLMIYR
SRAIDGAEYLSDRLEDFYDVELVVQNKANIEESLREFSSGERIEGVCVEVVPGADATPHT
IERSQHFLDCPKVLLVHPNRVAFDMETYELVTLRNVWSFDFDLSLASYVVDDASLRLDKE
SQEKWKRLSHRTHLGANYRLRSILTHAGDATIGHYYVYVNFDGEWVRFNDEVVESATEED
VRKSAFGGQSIQSRYRLFDNERASLLIYVNDDVKDELLNETPPPSAIVEVGRCIEEERTR
KEETHKVSYYLCDKSVVDVLDGVNGASDKLQRHMSVRLSPGQDEMAAIVTAAAKELHVAP
EQIRIFCRDRHGLSPWCAVESMCNSYDSYYYPPIFIDIAPPLAEEDAASATTAAAAAEPF
LAFLRNIESPHDRDVPVAIVRSIPELQARVPCDAVVYESRGGPQYLNAITATNQLVCGAN
LLYTHQRSSNDAVRGYLQHRQLVCTKVYLYDDYTAELTELFEIHIVESTPYTTLQVGLYK
MMTESKRGLPIPPSHNHLAFFKGNDRCNYAFAMPMATSLTIQWNTYNHTLRDVWGSAQHE
HKIVMTILPMPLEKIDLTVLVTFNGGYNNLPHVYVPLEGGSVTFRELLELMVQQLGSRLR
AGAAAGYEQQLAGQARLLRLLRVRRGELIEVVEDLDTPIDLETREDIVLDKLCPALPGYE
LVNVLFCRRRSGEYYFGLPTNICINSSLDEQGDVLLRRIVKKLGYPDQEEAMKKWILCVM
NVKSRKTRTASKKEVLADLVKEVGGAPFVFVVDRPQCLLLDGIEEEEHRPESIVIKSASK
TDLSTT
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcggggtacgttggcatctacaatcaaggtagcacgtgctacctgaactcggtc
atacaggcattgtaccacctacccgccttccgcacgcaaatttataacctcccgaatgtg
gaaaaagactccgtcgcactcgctctacgcgacgtgtttgcgcagctggaggtgcgcaac
cgcaacaccaccacaacggagctgaccaaggcttttggctggtcggcgcaggaggcggcg
gtgcagcatgacgttcatgagttgatgcagcagctctttgacagcctcgaaacgacgctg
aaggagacgtcgaagaagaacatgatccgcgacatgtttggcggcttgatgatctaccgg
tctcgtgccatagacggcgccgaatacctctctgaccgcctcgaggacttctacgacgtg
gagctggtagtgcagaacaaagcaaacatcgaggagtcgctgcgggagttctcatccgga
gagcggatcgagggtgtctgtgtggaggtggtgcctggcgcggacgcgacgccacacacg
atcgagcgcagccagcactttctcgactgccccaaggtgctcttggtgcacccgaaccgc
gtggcgtttgacatggaaacatacgagctggtgacgctgcgcaacgtgtggagcttcgat
ttcgacttgtcactggcgagctacgttgtcgatgacgcctcgctgaggctcgacaaggag
agtcaggaaaaatggaagaggcttagtcaccgcacccacctcggcgcgaactacagactg
cgctccatcctcacgcacgccggcgatgccaccatcgggcactactatgtgtacgtcaac
ttcgatggggagtgggtgcgcttcaacgacgaggtggtcgagtcggcaacggaggaggat
gtgcgcaagtccgcgtttggtggacagtcgattcagtcgcgctaccgcctcttcgacaac
gagcgcgcgtcgctgctgatctacgtgaacgatgatgtcaaggatgagctgctgaacgag
acgccgccaccgagcgcgatcgtcgaggtgggccgctgcattgaggaggagcgcactagg
aaggaggagacgcacaaggtgagctactacctatgcgacaagtctgtagtggacgtgctc
gacggcgtgaacggcgcctccgacaagctgcagcgtcacatgtccgtgcgcctgtctccc
ggtcaagatgagatggccgccatcgtcactgccgcagcgaaggagctgcacgtagcgcca
gagcagattcgcatcttctgccgcgaccgtcacggcctctccccatggtgcgccgttgag
tcgatgtgcaactcgtacgactcatactattacccacccatttttattgatatcgcgccg
ccgctcgcggaggaagatgcggcgtccgccacaactgccgctgccgccgccgagccgttc
ctcgcgttcctccgtaatatcgaatcgccgcacgaccgcgacgtccctgtcgcgatcgtc
cgctcgatccccgagctgcaggcgcgagtgccgtgcgatgcggttgtgtacgaaagccgc
ggcggcccgcagtacttgaacgccatcaccgcgacgaaccaacttgtgtgtggcgcaaac
ttactttatacgcaccagcgctcctccaacgacgcggtgcgagggtaccttcagcaccgc
cagctcgtctgcactaaggtctacctgtacgacgactacaccgccgagctgacggagctc
tttgaaatacatattgttgaatccacaccctacaccacgctgcaggtcgggctgtacaag
atgatgacagagtcgaagaggggtctgccaatccctccttcccacaaccacctcgcgttc
ttcaaggggaatgaccgatgcaactacgccttcgcgatgcccatggcgacgtcgctcaca
attcagtggaacacgtacaaccacaccctgcgagacgtgtggggtagcgcgcagcacgag
cacaaaattgtcatgacaattcttccaatgccgctcgaaaagatcgacttgacggtgctg
gtgacgttcaacggcggatacaataacttgccgcacgtctacgtcccactggagggcggc
agcgttacgtttcgcgaacttcttgaactgatggtgcagcagctgggcagtcgtctccgt
gcaggcgccgccgcggggtacgagcagcagcttgccgggcaggcacggctgctgcggctg
ctgcgggtgcgaagaggtgagctgattgaagtggtggaggacctggacactccgattgac
ctcgagacacgcgaggacattgttctggacaagctgtgcccggcactgcccgggtacgag
ctcgtcaacgtgctcttctgccgccgccgctcaggagagtactactttggtctaccgacg
aacatctgcatcaactcgtctctcgatgagcagggcgatgtgctccttcgccgcattgta
aagaagctggggtaccctgatcaggaggaggcaatgaaaaagtggatactttgtgtaatg
aacgtcaagtcgcgcaagacgcgcactgccagcaagaaggaggtgctggcagatctcgtc
aaggaggttggcggcgcaccgtttgtgttcgttgtcgaccgtccccagtgcttgctgctc
gacggtattgaggaggaggagcaccggccagaatccatcgttatcaagtcggcctctaag
acagacctctccacgacttag

DBGET integrated database retrieval system