KEGG   Leishmania major: LMJF_34_4530Help
Entry
LMJF_34_4530      CDS       T01014                                 

Gene name
TOR2
Definition
putative target of rapamycin (TOR) kinase 2
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
lma  Leishmania major
Brite
Protein kinases [BR:lma01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   LMJF_34_4530 (TOR2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
34:1837650..1844966
Genome map
AA seq 2438 aa AA seqDB search
MSSVDSEKLAASIRTLAGSRDERIAFVTEGVKQAKELQGKSVQEYEMVVSSLLMCLESFE
VVHGTSLDVLCELTVLDILLNLDLSVIQLSQCNSYLRLCLMAVNEIPVAVAAAKTFAQTL
SYSMTTDFVRTQIGETLEWISLSDAKSQPRRICGILVLTEVALRIPMVILPRLSEVFDRI
WDCLVVHDEEVRSRALCLFTLCAKLLVNRPAAIRAETCDSLMSHLKGNLASKSKDKRIAG
LLAFEPIVINSIGTSNIRYEDLSTLLVPYIVGGGANVNAETRELLFRCLVVLCRFSAPQF
VAHQLKDSVRFALDSINRNIQRNTAFEMLSEIIPIVGKAEFAPFVDDTCEVIKTIFEKSP
SPCWKALQCFSIICKECRPSKMETYVESCIENVFVWGLSAELIECMRAIIESSSAQYRAK
LEESLLDMISVTLCGLPFRQQIDAPRVSESSTDVSASEYEISVALNALKQFGFSNSELMG
DFLRVSVLPFIDSNSVAVRNAAVYTIVKLLIPPGEKGDLSIARRMCVNTVITRMLVVGLS
DPNPVVRQTILSAFTEDFYPYLSEQQYLFRFYSALGDESINCRVAATEQLCQMIRYDPSH
ILPALREEMVVLLHFITSTFNMNTVQNGFRLLAAIATRAPQLVVNFTEGICEALVPYFST
LSSRSSILLSFLHCCTAVAAALRKFGSTPFSSKREIALVCELLETLPADRSYHIIRLSCL
RFLSATLAPLMEGASPYVLYPRLFQQLCTLLHRTEESVDIRLEALRCIGVIGALDSHVFQ
SFNLNEKEKACEMSAVVVDRVTHVKCCRIVLGAVAALLDPESKRSAGAREGLLRTGVQTM
LNIFEHIPCSKSEIGLVIGPLARVIRQLPGGRLFATVLFEFCNIIRYAGAVVLNDLNEIY
RVFDNVWELQVNYRFLAVRMLSFVANFEASDNRHYGQQHSRILPQLFDTLNRADLRADLK
YAVLEYIVRHVDTLQPCTEAAVDNLLGALQNPANPLDFVNHCVVTLKEICLKLYVDELVG
AIVRCLLACLSVDLARKTRGRDSIALCNNIMGVFCVLIEELQGDFLKHSTYIIQALKNYR
ITNTEFGVMNNRVATGLRCARSPMSIQQQNAEVAALLKTCESVVMKSMSRMGEVWSYANL
NDDNANAGIAEERTMPINEQRLISPMKVVPLTKEEWVKWSDQFAITLLQESPFQVFRCTA
VPIGINAAPLVEKSTQFVQDTLQIAFRSMWNYASSALQTAITDFFRQSFRQAMMSTTVPA
EVVTMLLGIVEYMDHVGEALFISYNDLSECAWNRGMLAKALFWREAAYRDDPVGTVESLI
SLYSELHMVDSSVGILNMTSEEQRRSLLQTSLVKLARYTEALQLTQQELELEAAPSEASS
SESLSKARGYKNGSRGWSRMLHYTSNSDLTPSSLKAEESCRDRRVEVNARLMLCLSELGE
YDKVLEQWGSMLHNCKDRVTDTDEMHVLFFVSQYAADASIRLQSWDTLEHVLDWLPPDMV
LYHVSKAALEVVRGNYDAALVSVTNGRKVLLEDLTSLLHESYARAYEGLVVAQQLTEMEE
VIIAKQTQKALSSAAHIPHLCHIWEQRIRMMHATVPTWKQVLGIRGLLISPHEDVKTRIQ
FTKLCRQEKAGQLEKFTLAELLGFANPTLEQLTSRNVNPRVVMQYISYLSDTNALGPGSA
FGTESDLIKKMIDVHTKAQNSAVLARAYTRLGSKVDLIESVQCFKTAIMYDPQWFLAWRK
WAEANAQLLQTDKGEETCRNAIEGFIRSIQLGTSDSTLIQDVLKLLTLWSSHCDSDHNLK
ELRERVFDVPSRVWHLVVPQLVARLDTGSDDSCRLVADVLTNVGYDYPHTLVYPLNLCTM
SDSERRKRYSNEVLGKLQERYPVIVLQGRLMIDELIRVSALIYEQWYDKLEAAATAFFGR
RSTDEMIRTLLPIHETLTRVPETVVESEFLSKYSKRLTEARDWLRSYSSTRYTGDIQSAW
KLYHSVYCNIDKQIKSSDTLQLQFCSPKLFEARNLSIGIPDARPVREESVAKVNRFQKDI
IVIASKQRPKRIGIITAEGKLQKFLLKGREDLRLDERVMQLFSLVNILMQSDSRASKNLG
FQIQRYSVTPLKDNVGIIGWVDGCDTLHEVVKHFRERKSIPVELEMRMLDQIITFDNSKA
YDYLTIMSKVEVLEFLSDHTSGQDIRKAMWSTSPNCEVWYDRRRMYTTSLANMSIVGYIL
GLGDRHPNNIMLQRASGLVVHIDFGDCFEVAMTRDKFPEKVPFRLTRMLRSALDVSGVDG
AFRACSETAMCVLREGSHSVLALLEAFIQDPLISWRLINRHGQEPESSNDHKTIEEQVNI
ANMRNATSAAEAESMCDSFGQRDSGPFSVAKHLCGEEVDVVHQGVFIVKRLSSKLKGQDF
ISAGTELLDPRTQVGQLIEEATDVTNVAQSWSGWYPFW
NT seq 7317 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcggtggactcggagaaactcgcggcctccatccgcacactagccggcagtcga
gacgagcgcattgcctttgtgacggagggggtgaagcaagcaaaggagttgcagggcaaa
agcgtgcaggagtatgagatggtggtgtcgtcgctgcttatgtgtctcgagagctttgag
gtggtgcacggcacgtcgcttgatgtgctctgcgagctcactgttctggacattctgcta
aacctagacttgtctgtcattcagctgtcgcagtgcaacagctacttgcggctttgtctc
atggcggtgaatgaaatccccgtcgctgtggcagctgcaaagacgtttgcgcagacgctt
agctacagcatgacgacggattttgtgcgcactcaaatcggagagacactcgagtggatt
tcgctctccgatgccaagtcgcagcctcgtcgcatttgtggcatcttggtgctcacggag
gtcgcgttgcgcattccaatggtgattctgccacggctctccgaggtgttcgacaggatt
tgggactgcttggtggtgcacgacgaggaggtccgctcgcgcgctctgtgtctcttcacg
ctatgcgcaaagcttctggtcaaccgccctgctgccattcgtgctgagacctgcgactca
ttgatgtcacacctgaagggtaacctcgcctctaaatcgaaggacaaacgcatcgctggc
ctccttgcattcgagcccatcgtcatcaactcgatcggcaccagcaacatacgctacgaa
gacctctccacccttctcgtcccgtacattgtggggggcggcgcgaacgtcaacgccgag
acgcgcgagctcctgttccgctgcctggttgttctctgccgcttcagtgcaccacagttt
gtcgcgcaccagctcaaggacagcgtgcgcttcgcgctggactccatcaaccgcaacatt
cagcggaacaccgccttcgagatgctctctgagatcattccgattgtaggcaaggcagag
tttgcacccttcgtagacgacacgtgtgaagtaatcaagaccattttcgagaagtccccg
agtccgtgctggaaggcgctgcagtgtttctccatcatctgcaaagagtgccggccatcc
aagatggagacatacgtggagtcgtgcatcgagaacgtgttcgtgtggggactttccgcg
gagctgattgagtgcatgcgcgccatcatcgagtcgtcgagcgcgcagtaccgagcaaag
ctggaggagtcgctgcttgatatgatctccgtcacactatgcggtctcccattccgacag
cagatcgacgcgccacgcgtcagtgagagctcgacggatgtgagcgcctccgagtatgag
atctccgtcgccctgaacgccctcaagcagttcggcttctccaactcggagctcatgggc
gactttctgcgcgtctcggtgctgccttttatcgacagcaacagcgtcgccgtgcgcaac
gcagctgtctatacgatcgtcaagcttctcatcccccctggcgagaaaggcgacctcagt
atcgcacgtcgcatgtgcgtcaacactgtcatcacgcgcatgctggttgtagggttgtca
gaccccaatccggtggtgcgtcagaccattctgagtgcctttacagaggacttttatcca
taccttagcgagcagcagtatctctttcgcttctattctgccctgggtgatgaatccatc
aactgtcgcgtggcggcgacggagcagctgtgccagatgatccgctatgacccgtctcac
attctgcctgcgctacgagaggagatggtcgttcttctacacttcattacgtccaccttc
aatatgaacaccgtccaaaacgggttccgcctcctcgccgcgatcgcgacgcgcgcgccg
caactggtagtgaactttacggaaggcatctgcgaggccctggtgccgtactttagcact
ctctcctcccgctccagcattctcctgtcgtttttgcactgctgcacagccgtcgcagca
gcgctccggaagtttggcagcacccccttctcctccaaacgtgaaatcgctctcgtgtgc
gagctgctggaaaccttgccggcggaccggtcgtatcacatcatccggctgtcctgtctc
cgcttcctctcagcaaccttggcaccgctcatggaaggtgcctcgccgtacgtgctgtat
cctcggctctttcaacagctctgcacgctgctgcacagaacagaggagagcgtcgatatc
cgcctagaagcgctgcggtgcattggcgtgatcggtgcgctggactcgcacgtgttccag
tccttcaatctcaacgagaaggagaaggcatgtgagatgagcgcggtggtggtggacagg
gtgacacacgtgaagtgctgccgcattgtgctcggcgcagtggcggcgctgcttgacccg
gagagcaagcgctccgccggcgcgcgcgaagggctgctgcgcacgggtgtgcagacgatg
ctgaacatttttgagcatattccatgctccaagagtgaaatcggtctcgtgatcgggccg
ctggcccgcgtcatccggcagctgcctggcggccgcctctttgcaaccgtgctcttcgag
ttctgcaacatcattcgctacgcgggtgcggtggtgctgaacgatttgaacgagatttac
cgcgtatttgacaacgtatgggagttgcaggtcaactaccggtttttggccgtgcgcatg
ctctcgtttgtcgccaacttcgaagcctccgacaatcgacactacggccagcagcactcc
cgcatcctgccgcaactcttcgacacgctcaaccgtgctgacctccgcgccgacctcaag
tacgccgtacttgagtacattgtgcgccatgtcgacaccctgcagccgtgcacggaggcg
gcggtggataacctcctcggcgccctacagaacccggcaaatccgcttgactttgtgaac
cactgtgtggtgacgcttaaggagatctgcctcaagctgtatgtcgatgagctcgtcggc
gctattgttcgatgtctgctggcatgcctctccgtcgaccttgcacgcaagacacgcggg
cgcgatagtattgctctctgcaacaacatcatgggggtcttctgtgtcctgatcgaggag
ctgcagggcgattttctcaagcactcaacgtacattattcaggccttgaagaactaccgc
atcacaaacacggagtttggcgtcatgaacaaccgcgtcgccaccggcctccgctgtgca
cgcagcccgatgtcgatccagcaacaaaacgcggaggttgccgcgctgctgaagacatgc
gaatccgtcgtgatgaagagcatgtcgcgcatgggcgaggtgtggagctacgcaaacctc
aacgacgacaacgcaaatgcagggatcgccgaggagcgcaccatgcctatcaacgagcag
cgtctcatcagccccatgaaggtcgttcccctcacgaaggaggagtgggtcaagtggtcg
gaccagttcgccatcacgctgctgcaagagtcgccgtttcaggtcttccgctgcacggcg
gtgcccatcggcatcaacgcagccccgctggtcgagaaatcgacgcagtttgtgcaagac
acactccaaatcgcctttcgctccatgtggaattacgcgagctcagcgctgcaaaccgct
atcacagactttttccggcagtcgtttcgtcaggcaatgatgtcgaccactgtcccggcg
gaggtggtgacgatgttgcttggcatcgtggagtacatggaccacgttggcgaggccttg
ttcatctcgtacaatgacctctccgagtgtgcgtggaaccgcggaatgctggccaaggcg
ctcttctggcgcgaggccgcgtaccgcgacgaccctgtcggcaccgtcgagtcgctcatc
tctctctacagtgagctacacatggtggattcctcggttggaatcttgaacatgacgagc
gaggagcagcggcgcagcctgctgcagacaagcctggttaagctcgcgcgctacacggag
gcgctccagctgacacagcaggagctggagctggaggctgccccgtcggaggcgagcagc
tcggagagcttatccaaggcccgcgggtacaagaacggcagccgcggctggtctcgcatg
ctgcactacacgtccaacagcgatctcaccccgtcctccttaaaggcggaggagagctgt
cgcgaccgccgcgttgaggtgaacgcgcgactgatgttgtgcctgagcgagcttggcgag
tacgacaaggtgctggagcagtggggcagcatgctccacaactgcaaggaccgcgtgaca
gatacagacgagatgcacgtgctcttttttgtctcgcagtacgccgcagacgcgtcgatc
cggctgcagtcgtgggacacactggagcacgtcctggactggttgccgccggacatggtt
ctctaccacgtgtcgaaggcggctctggaggtggtgcgcggcaactacgacgccgcgctc
gtctctgtgacgaacgggcgcaaggtgcttctggaggatctgacaagcctgctgcacgag
tcgtacgcgcgcgcctacgaggggctggtggtggcgcagcagctgacggagatggaggag
gtcatcatcgcgaagcagacgcagaaggcgctcagctctgccgcacacataccgcatctc
tgccatatatgggagcagcgcattcgaatgatgcatgcgacggtaccgacatggaagcag
gtgctggggatccgcggcctactcatctcgccccatgaagacgtgaagacacgcatccag
ttcaccaagctctgtcggcaggagaaggcgggacagctagagaagtttacgctggccgag
ctcctcgggttcgcaaacccgaccctggagcaactcacgagccgtaatgtgaacccacgc
gtggtgatgcagtacatctcatacctctccgacaccaacgcacttggccccggcagcgcc
ttcggaaccgagagcgacctcatcaagaagatgattgacgtgcacaccaaggcgcaaaac
tcggcagtgttggcgcgggcctacacgcgcctcggcagcaaggtcgatctcatcgagtcg
gtgcagtgcttcaagacggccatcatgtacgacccacagtggtttctggcgtggcgtaag
tgggccgaggcgaacgcgcagctgctccagacagacaagggcgaggaaacgtgccgcaac
gcgatcgagggctttatccgaagcattcagctggggacgtccgactcgacgctcattcaa
gatgtgctcaagctgctcacgctctggtcgagccactgcgactctgatcacaacttgaag
gagctgcgcgagcgtgtcttcgatgtgccgtcgcgcgtgtggcaccttgtggtgccacag
ctggtcgcccggctcgacaccggctccgacgacagctgccggcttgtggcggatgtcctg
accaacgtgggctacgactacccccacacattggtgtacccgctgaacctgtgcaccatg
tctgattcggagcggcgtaagaggtactccaatgaggtgctgggtaagctgcaggagcgg
tatccggtgattgtgctgcagggtcgtctcatgattgacgaactcatccgcgtctcggcc
ctaatctacgagcaatggtacgacaagctggaagcggcggcgaccgccttctttggccgt
cgcagcaccgatgagatgatacgcacgctgctgccgattcacgagacgttgacacgggtg
ccggagacggtggtggaatctgagtttctgtccaagtacagcaaacgtctgaccgaggcc
cgggattggctgcggtcgtactcgtcaacgcgttacaccggcgacattcaatctgcatgg
aagctgtaccacagcgtgtactgcaacatcgacaaacagatcaaatcgagcgacacacta
cagctgcagttctgcagcccgaagctgttcgaggcgcgcaacctctccatcgggatcccc
gacgcgcggcctgttcgcgaggagtcggtagcgaaggtgaaccgctttcagaaagacatc
atcgtcatcgcaagcaagcagcggccgaagcggatcggcatcatcacggcggaggggaaa
ttgcagaagttcctgctcaaagggcgcgaggatctgcgcctggacgagcgtgtcatgcag
ctcttctcgctagtcaacatcctcatgcagtccgactcgagggcgagcaagaacttaggc
ttccaaatccagcgctactctgtcacgccgctcaaagacaacgtcggtatcattggctgg
gtcgacggctgcgacacgctgcacgaagtcgtcaaacactttcgcgaacgcaaatcgatc
ccggttgaactggagatgcgtatgctggaccagatcatcacctttgacaactccaaggcg
tacgactatctgaccatcatgtcgaaggtagaggtactggagttcctctccgatcacacc
tccgggcaggacattcgcaaggccatgtggagcacatcgccgaactgcgaggtctggtac
gatcgacgccgcatgtacacaacgtccttggcaaacatgagcatcgtaggctacattctc
ggcctcggcgaccgccacccaaacaacatcatgctgcagcgcgcgtcaggattggtggtg
cacatcgactttggtgactgctttgaggtggccatgacgcgcgataagttccccgaaaag
gtgccgttccggttgacacgtatgttgcgcagcgcactcgacgtgtcgggcgtcgacgga
gcctttcgtgcctgctcggagacggcgatgtgcgtgttgcgcgagggtagccacagtgtg
ctggccctcctcgaggcattcattcaagacccgcttatttcgtggcgcctcatcaacaga
catggacaggagcctgagtcgtcgaacgatcacaagaccatcgaagagcaggtgaacatt
gccaacatgcgcaacgccacgtcagcggcggaggcagagtccatgtgtgactcgttcggg
caacgcgatagcggtccgtttagtgtcgcaaagcacttgtgtggggaggaggtggatgtg
gtgcatcagggtgtgttcatcgtcaagcgcctcagctccaagctgaaagggcaggacttt
atctcggctggcacagagctcctcgacccacgcacgcaagtagggcagctcattgaggaa
gccacagacgtcaccaacgtggcacagtcctggtcaggatggtacccgttctggtag

DBGET integrated database retrieval system