KEGG   Leishmania major: LMJF_36_0720Help
Entry
LMJF_36_0720      CDS       T01014                                 

Definition
putative mitogen-activated protein kinase
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
lma  Leishmania major
Brite
Enzymes [BR:lma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     LMJF_36_0720
Protein kinases [BR:lma01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   LMJF_36_0720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
36:211089..212384
Genome map
AA seq 431 aa AA seqDB search
MSAEIESHILKKYEIQAQLGQGAYGIVWRALERKHNRVVALKKIYDAFQNSTDAQRTFRE
IMFLHRLHHPNIIKLLHVHRAFNDRDIYLVFEYMETDLHVVIRANILEEIHKQFIIYQLL
KTMKYLHSAEILHRDMKPSNLLVNSDCTMKVADFGLARSILSLEGEQASRPVLTDYIATR
WYRPPEILLGSTRYTKGVDMWSVGCILAELMLGKPIFPGRSTTNQLELICSVTGMPSAAD
VAATNSQFAHAMLRDIHCAHRRTFAELLPSASADALDLIERFMRFNPNRRISAAEALEHP
YVAAFHRPDEEAVAPEPITVSLPDSQRLPLAKYRDAIYEQIAALRRSSTSADQRQRAERQ
TAGSTASRKTSVSSTAARAAPQRSAVKPTSTSAVSEASSSKAYARPAFRSATSAASGLES
RPVAREAAVRK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcggaaattgagtcgcatattctgaagaagtatgagattcaagcacagctagga
cagggtgcctacggcatcgtttggcgcgccctggagcgcaaacacaaccgcgtcgttgca
ctcaagaaaatttacgacgccttccaaaactcgaccgatgcgcagcgcaccttccgcgag
atcatgtttctgcaccggctgcaccacccgaacatcatcaaactgctgcacgtccatcgt
gccttcaacgatcgcgacatatacctggtcttcgaatacatggagaccgacctgcacgtg
gtgattagggcaaacatcttggaggaaatccacaaacagttcatcatctaccagctgctc
aagacgatgaagtacctgcattctgctgagattcttcatcgtgacatgaaaccaagcaat
ctgctggtaaacagcgactgcacaatgaaggtggctgacttcggtctcgcgcgctctatc
ctgtcccttgagggcgagcaggcgtcacggccggtgctaacggactacattgcgacacgg
tggtaccgcccgccggagattttgctcggttcgacacgatacaccaagggcgtagatatg
tggtcggtgggctgcattcttgcggagttgatgctgggaaagcccatctttcccggccgc
tccaccacgaaccagttggagctgatctgcagcgtgacgggcatgccctccgcggcggat
gtggcggcgaccaactcgcagtttgctcacgcgatgcttcgcgacatccactgcgcgcat
cgacgcacgttcgctgagctgctgccgagcgcttctgccgatgcgctggacctgatcgag
cgctttatgcgtttcaacccgaaccgtcgtatatctgccgccgaggccctggagcacccg
tacgtcgctgcctttcaccgtcctgacgaggaagcggtggcaccggaacccatcaccgtc
tctcttcccgacagccagcgtttgcccttggccaagtacagggacgccatctacgagcaa
attgccgcactgcgccgtagctccacgtccgccgatcaacggcagcgcgcggagcgacag
accgccggcagcaccgctagccgcaagacgtccgtcagcagcaccgccgcacgggcggct
ccccagcgcagtgctgtgaagcccacctcgactagtgcggtcagcgaagcatcatcttcg
aaggcgtacgcccgtcccgccttccgctcggcaacgtctgccgcctctggtctggaaagt
agacccgtcgcgcgtgaggcagcggtgcgcaagtga

DBGET integrated database retrieval system