KEGG   Leishmania major: LMJF_36_0800Help
Entry
LMJF_36_0800      CDS       T01014                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
lma  Leishmania major
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:lma00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    LMJF_36_0800
  Replication and repair
   03420 Nucleotide excision repair
    LMJF_36_0800
Transcription machinery [BR:lma03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     LMJF_36_0800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
36:283379..285259
Genome map
AA seq 626 aa AA seqDB search
MHTLLFLSALGDPTTASEVGAEGVRRRVVFSEAHPPLLLTTIGTSGHTALSKEHAEALAV
ISGNMSSSSSALDVPLVEVICSYPTREGLCAECPALLLLVYEHVVAELQAGRRAVDVFRG
TSRQDHLSELLAVRSLSELFERLYPLSQSCILDESTASSQFWRQARVTLEAAWAAPHDAK
GRALLTQVRGQPRFHFCGPRDVETPGEGYPLHPVSLERALATSKRFLRTAMTCALDGSTD
ALAGRQPELRAVLQLAHLVPLTPSTGAPPRKEVTPEGLSFCMVSLQQRWWILVNAALERV
LLLTRAAVNGNGNTSGSSGVTKPLLWQLLAVLSVLDTTQYVFAFPERQQDLAAHHLLARL
SEVGLVYPLLSNDRKCFVLSPDFLHAIHWHASAPLSLTFNHHLLRSASGVSGAGIGDLRR
EDTDTIITETNFRLFAYTNDADLLNILNQFAELEEIVNGNLHCYRVTRASFAAAMRKGIT
AAQVLRFLSLRAHPSMLRRHGEREENGDTASPSSAGGASSSFTFSASPRRGAVAGTCGST
TSIDAVSTLVVPQSFCDQMRMWESECRRVVFEHHVVLLRNMSTQQQKAVTAYLTDAGEVD
AVVHAERGYMVIREEVFERLVAPLLG
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgcacacgcttctctttctttctgccctgggcgatccgaccacagctagcgaagtggga
gccgaaggcgtccggcgccgtgtcgtcttctcagaggcgcacccccccctcctcctcacc
accataggtacaagtggccacactgccttgagtaaagagcacgcagaagctctcgcggtg
atcagcggcaacatgtcctcgagctcctcagcattggacgtgccacttgtagaggtcatc
tgcagctatcccacccgcgaggggctatgcgccgagtgccctgcactgctgctgctcgtc
tacgagcacgttgtagcggagctgcaggcggggcgacgcgctgtggacgtgttccgtggc
acctcgcggcaggaccacctgagcgaattgctcgctgtgcgctccttgtcggagctgttt
gagcgtctttacccgctgtcgcagtcttgcatcctcgatgagagcactgcgagttcgcag
ttctggaggcaggcacgggtgaccttggaagccgcgtgggcggcgccgcatgacgccaag
gggcgtgcccttctcacgcaggtgcgcggccagccgcggttccacttttgcgggccgcgc
gacgtcgagacgcccggggagggctatccactgcaccccgtatcgctggagcgggccttg
gcaactagcaagcgcttcctccgcactgcgatgacctgcgcactggacgggtcaacggat
gccctggccgggcggcaaccggagctgcgcgcggtgctgcagctggcccaccttgttccc
cttactccgtcgacaggggcacctccgaggaaggaagtcacgccggaggggctcagcttc
tgcatggtgtcgctgcagcagcggtggtggatactggtgaacgcggcgctggagcgcgtt
ctgctgctcactcgcgctgccgtgaatgggaacggtaacaccagcggcagcagcggcgtc
acaaaaccgcttctgtggcagctgctggcggtgctgtctgtgttggacactacgcaatac
gtcttcgccttcccagagagacagcaggatctcgcggctcaccatcttctcgcacggctg
tccgaggtcgggctggtgtaccccttactcagcaacgaccgtaagtgctttgtcttgagt
cctgacttcctgcacgccattcactggcacgcgagtgcgccgctgtccctcaccttcaat
catcacctcctgcggagcgctagcggcgtcagcggtgccggcatcggcgacctacgtcgc
gaggacacggacaccatcatcaccgaaacgaacttccgtctgttcgcctacaccaacgat
gccgacctgctcaacattttgaaccagtttgcagaactggaggagatcgtaaacgggaat
ctccactgctaccgcgtgacgcgggccagctttgctgccgcgatgcgcaagggcattacc
gccgcacaagtgctacgctttctttcgctgcgagcgcaccccagcatgcttcgccggcac
ggggagcgggaggagaacggagacacggcgtcgccatcgtccgctggtggcgcctcctct
tccttcactttttcagcgtcccctcgtcgtggggctgttgcgggtacgtgtgggagcacc
acctccattgatgctgtgtcgacgcttgtggttccgcagtccttctgcgaccagatgcgc
atgtgggagagcgagtgtcgccgcgtagtgtttgagcaccatgttgtcctgctacgcaac
atgtcaacgcagcagcagaaggcggtgacagcgtatttgactgatgcaggggaggtcgat
gccgttgtgcacgccgagcgcggctacatggtgattcgtgaggaagtcttcgagcgtctt
gtcgcaccacttttggggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system