KEGG   Leishmania major: LMJF_36_1630Help
Entry
LMJF_36_1630      CDS       T01014                                 

Definition
putative clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
lma  Leishmania major
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:lma00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    LMJF_36_1630
Exosome [BR:lma04147]
 Exosomal proteins
  Proteins found in most exosomes
   LMJF_36_1630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
36:complement(631832..636874)
Genome map
AA seq 1680 aa AA seqDB search
MDSPSISTEVFQLNSVSGGLRPGSISFKNVTLESEKYVCVRDVQGDGPTSLVIVDLEKRE
SIRNNVKDAESCIMNPKSKILALRSGRNLQVFDVDASRRLKATLFHEDVAYWRWIDDRTL
GIVTAKAVYHWSLDTATDAPQHIFDRSADYDSSVQILSYRSDEQKKWLVVTGVARDPSGT
MVGKALLYSVENRSSRVLDGHACCFISTSTPSEPRKCNVMCLAWNSPQQGGQVMIMELPT
GSKTDLSVLRRVYSVHIQPGDFPVAMNVSDRHKLLTVATSRGSFVLMDIFTGTILVEQQF
SSSVVFCGAADNKVGGVLCVNNQGAVMRIGPNNDGIIDFVKNRMHNAELALRIASTANLG
GVDDLFKVQLDNFLRNGNVEEAVRTCLRAPGNSLRTREILMRFMQMPQQPGQPPAISTYF
KIALAETSLNECESVELARAVVPKGGIGYVKQQFDEGKLTASEELGDLVQQADSTMALKI
FHQGNAHAKVLNLLLQRNETQKAVEYCKRASFSPDWRVIMNNFIRVAPQDAVNLGLMLYR
EMGDRPVLTADEVVDMFVSAQQIQQATEFLLEILRNHNDESTMELQTKLLEMNLKYSHPS
VADKIFVRKICQCYDGMRLAPLCERAGLHQHAIDCYIMAQQQDSDLNNLASIRRCLQQLQ
NFNPEWIVDFFGKLNKQDSLKCLEDLCTDSRQNFKVIVQVATKYSDALGAADLINLFLEH
SLYDVLYYYLGAVVPYTRDPEVHFRYIEAAAEMGQMQELERMTRESPCYDAERTKNYLKS
KQLTDMWPFINVCDQHNMVNEMVHYLVETGNESFIEQYVTRRNPGKTPQVVQALIECNVS
EERIKNMLTVVGAMCPIEELVDRVEEVGRLHLIKQWLEDRRSEKKTDKALYNALAKIYVD
IGQSPEQFLSENEYYDAQVVGKYCETRDPNLAYIIYCCGHCSEMMIDLCHRNGMYKQLAR
YLVKEQSLDLWASVLGQNSAERQQLIESVQQIALPESESSEEVSTTVRAFMNANLTEELT
SLLGQIVVHGRFRKNRFLENLLIMSAVRARKDKVMEYVTTLEDYDAKDIAHVASGAGMHE
IAFVVYTRHNMQKEAMTVLLQDMNDISRGRAFAQKTDTAVVWSMLGEYLVKQDEVNEGIE
CLIRAKNPDLVVEVTSAAERTNQFGDLIKYLTMARQCSRAKDNKIDTALVITYAKTGRLE
ELEEFLKQTHNVKIGAIADKCFQDKLYESARVLYTVANNYARVASTEVMLNNLPAAVEAA
KKAKSIHAYKEANLACIEAGDLKLAGVCAVPVVLKAEEVSGMCNRYESRGLWEELFSVLR
NASSHQGAHMSIFTEMGVLLAKYRPEKLMEHVIMYAKKINTHKMITVCEQYHHWVVLRVL
HTNNEDWLAATNSMMQHHADAFDHEIFKDAVSHLGASELLYTAIGFYLKTHPDQLNDFLS
SIFKRVDPERVMAETTKVAPIHVIRTYLEAAQERNAKKVNEALNNLYIEEDDFKALRHSV
ETYNNFDSEELSSRLEKIELFEFRKIALLLHRRNKRYSHAIAVAKANELFEEAIDTAAES
GDSELVNKLLDYFAKDYPECFAACLYACYDLLKPATVLQKAWLNQRTEMAMPYMIQVLQD
YSSKIEKMEKLMMDAQTAAKDAARRAGPVQDPRSVPLMIEQGGGMPMNGMPPQFGSGRPF
NT seq 5043 nt NT seq  +upstreamnt  +downstreamnt
atggactctccttcgatttctacggaggtctttcagctcaactcggtctcaggcggcctc
cgcccgggctccatctccttcaagaatgtcacgttagagagcgagaagtatgtctgcgtc
cgcgatgttcagggcgatgggccgacgtcactcgtcattgtcgatctcgagaagcgcgag
agcattcgaaacaacgtcaaggatgcggagtcgtgcatcatgaaccccaagtcgaagatc
ctggcactacgcagcggccgcaatctgcaggtgttcgatgtggatgcctcgcggcggctc
aaggcgacgctctttcatgaggatgttgcgtactggcgctggatcgacgaccgcaccctt
ggcattgtgacggcaaaggctgtctaccactggagcctcgacaccgccaccgacgcgccg
cagcacatcttcgaccgaagcgcggactacgacagcagtgtgcagattctctcgtaccgc
agtgacgagcagaagaagtggctcgtcgtgactggtgtggcgcgtgacccatcgggtacg
atggtgggcaaggcgctgctgtacagcgtcgagaaccgcagcagtcgcgtgctcgacggt
catgcgtgctgcttcatctctacctccaccccgtcggagcctcgcaagtgcaatgtgatg
tgcctcgcctggaacagcccgcagcaaggtggccaggtcatgatcatggagctaccgacc
ggctccaagacagatttgtcggtgctgcggcgggtttacagcgtacacattcagcccggc
gacttcccggtggccatgaacgtctcggaccgccacaagctgttgaccgtggcgacgagc
cggggcagctttgtgctgatggacatcttcaccgggaccattttggtagagcagcagttt
tcgagctcggtggtgttttgcggcgcagctgacaacaaggtcggcggcgtcttgtgcgtc
aacaaccagggcgccgtcatgcgcatcggccccaacaacgacggcatcatcgactttgtc
aagaaccgcatgcacaatgccgagctggccctgcgcatcgcttccacagcgaacctcggc
ggcgttgatgacctcttcaaggtgcagctggacaacttcctgcgcaatggcaatgtcgag
gaggcagtccgcacgtgcctgcgtgcgccggggaactcgctgcgcacgcgcgagattctc
atgcgtttcatgcaaatgccgcagcaaccgggccagccgccggctatctcaacctacttc
aagatcgcgctggcggagacaagcctgaacgagtgcgagtctgtcgaacttgcgcgcgcg
gtggtgcccaagggcggcatcggctacgtgaagcagcagtttgacgagggcaagctgacg
gcctccgaggagctgggcgacctggtgcagcaggcggactccaccatggcgctgaagatc
ttccaccagggcaacgcccacgccaaggtgctgaacttgctgctacagcgcaacgagaca
cagaaggcggtggagtactgcaagcgcgcgagcttctcgccggattggcgtgtcatcatg
aacaacttcatccgagttgcgccgcaggacgctgtcaaccttggcttgatgctgtaccgt
gagatgggcgacaggccggtgctcacggcggatgaggtggtagacatgttcgtgtcggcc
cagcagattcagcaggcgaccgagttccttctggagatcctccgcaaccacaatgacgag
tcgaccatggagctgcaaacgaagctgctcgagatgaacctcaagtactcacatccatcc
gtcgccgataagatcttcgtccgcaagatctgccagtgctacgatggcatgaggctggca
cccctttgcgagcgtgctggtctgcaccagcacgcgattgactgctacataatggcgcag
cagcaggactccgacctcaacaacctcgccagcatccgccgctgcctgcagcagttgcag
aacttcaaccccgagtggatcgtagactttttcggcaagctcaacaagcaggacagcctc
aagtgcctcgaggatctctgcaccgactcgcgccagaacttcaaggttattgtgcaggtg
gccaccaagtacagtgacgccctgggcgccgccgacctcatcaacctattcctcgaacac
agcctgtacgacgtcctctactactacctcggggccgtggtgccgtacacgcgtgatccc
gaggtgcacttccgctacatcgaggccgctgctgagatgggtcaaatgcaggagctcgag
cgcatgacccgcgagagcccgtgctacgacgccgagcggacgaagaactacctcaagagc
aagcaactgacggacatgtggcccttcatcaacgtgtgcgatcagcacaacatggtgaac
gagatggtgcactacttggtggagacgggcaacgagagcttcatagagcagtacgtgacg
cgccgaaaccccggcaagacgccgcaggtggttcaggccctcatcgagtgcaacgtgagc
gaggagcgcatcaagaacatgctcacggtggttggggcgatgtgtcctattgaagaactc
gttgaccgtgtagaggaggtgggtcggctgcacctcatcaagcagtggcttgaggaccgt
cgcagcgagaagaagacggacaaggcgctgtacaacgctctggccaagatctacgtcgac
attggccagagccccgagcagttcctgtcggaaaacgagtattacgatgcgcaggtggtg
ggcaagtactgcgaaacgcgcgaccccaacctggcatacatcatctattgctgcggccac
tgcagcgagatgatgatcgacctctgccaccgcaacggcatgtacaaacagctggcccgc
tacctggtgaaggagcagagccttgatctatgggcgagcgtgctggggcagaactcggcg
gagcggcagcagcttatcgagtcggtgcagcagatcgcgttgccagagagcgaatcgagc
gaggaggtgagcacgacagtgcgcgccttcatgaacgccaatctgacggaggagctcacc
tcactgctgggccagattgtggtgcacggccgcttccgcaagaaccgcttcctcgagaat
cttctgatcatgtctgcggtgcgtgcccgcaaggacaaggtgatggagtacgtgacgacg
ctggaggactacgacgctaaggacattgcgcacgtcgcctcgggcgccggcatgcatgag
atcgcgtttgttgtatacacgcgccacaacatgcagaaagaagccatgacggtgctcctg
caggacatgaacgacatttcgcgcggtcgcgcctttgcccaaaagacggacactgccgtc
gtgtggtccatgctaggtgagtacctggtgaagcaggacgaggtaaacgagggtatcgag
tgcctcattagggcgaagaaccccgacctcgttgtcgaggtgacgtctgcggcggagcgc
acgaaccagttcggcgacctcatcaagtacctcacgatggcccgccaatgctcgcgcgcc
aaagacaacaagattgacacggcgctcgtcatcacgtacgccaagacgggccgcctcgag
gagctagaagagttcctaaagcagacgcacaacgtcaagatcggcgccattgccgacaag
tgcttccaggacaagctgtacgagtcggcgcgcgtgctgtacaccgtggcgaacaactac
gctcgcgtggcgtcgacggaggtgatgctgaacaacctgcccgccgccgtagaggcggcc
aagaaggccaagtcgatccacgcgtacaaggaggccaacctggcatgcatcgaggctggg
gatctgaagctggccggcgtctgcgccgtcccagtcgttctcaaggcggaggaggtgagt
ggcatgtgcaaccgctacgaaagccgcggcctctgggaggagctattctcggtgctcagg
aatgcctctagccatcagggcgcgcacatgtccatcttcaccgagatgggcgtcttgctg
gccaagtatcgacccgagaagctcatggagcacgtgattatgtacgcaaagaagatcaac
acgcacaagatgattaccgtctgcgagcagtatcaccactgggtcgtgctgcgtgtgctg
cacaccaacaacgaggattggctggctgcgaccaactccatgatgcagcaccacgcggac
gccttcgaccacgagatcttcaaggacgcggtgagccacctcggcgccagcgagctcctc
tacaccgcgatcggcttctacctcaagacgcacccggatcagctgaacgacttcctgtcc
tctatcttcaagcgcgtggatccggagcgggtgatggcggagacgacgaaggtggcgcca
attcacgtgattcgcacttacctcgaggccgcgcaggagcgcaacgccaagaaggtgaac
gaggccctcaacaacctctacatcgaggaggacgacttcaaggcgctgcgccactccgtc
gagacgtacaacaacttcgactcggaggagctgtcgtcgcggctagagaagatagagctc
tttgagttccgcaagatcgctctgctgctgcaccgcaggaacaagcgctattcgcacgcc
atcgcggtggccaaggcgaacgagctgttcgaggaggctatcgacacggcagccgagagc
ggcgacagcgaactggtgaacaagctgctggactacttcgcgaaggactatcccgagtgt
ttcgcagcgtgcctctacgcatgctacgacttgctgaagccagcgacggtgttgcagaag
gcgtggctgaatcagcgaacggagatggcgatgccgtacatgatacaggtgctccaggac
tactcgagtaagatcgaaaaaatggagaagttgatgatggacgcacagaccgcggcaaag
gacgcggctcgtcgcgccggtccggtgcaggacccccgctcggtgccgctaatgatcgag
cagggtggcggcatgccgatgaacgggatgccgcctcaattcggatctggccggcctttc
tag

DBGET integrated database retrieval system