KEGG   Leishmania major: LMJF_36_2260Help
Entry
LMJF_36_2260      CDS       T01014                                 

Definition
(RefSeq) guanylate kinase-like protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lma  Leishmania major
Pathway
lma00230  Purine metabolism
lma01100  Metabolic pathways
Module
lma_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lma00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LMJF_36_2260
Enzymes [BR:lma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LMJF_36_2260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 Rad17 AAA_16 RNA_helicase AAA_22 RsgA_GTPase ABC_tran AAA_18 AAA AAA_28 MMR_HSR1 AAA_29 NACHT AAA_5 Mg_chelatase Viral_helicase1 G-alpha
Motif
Other DBs
NCBI-GeneID: 5655485
NCBI-ProteinID: XP_001686803
GeneDB: LmjF.36.2260
UniProt: Q4Q1J5
Position
36:904028..905017
Genome map
AA seq 329 aa AA seqDB search
MSVAPKAPMPAISSVAAASAARKASQQAVGPLKGTVALRRLVDVLLFVGPSGCGKSTVIR
RLQRDWPTLFEFSVSHTTRCPRPGEVHGQHYYFVTMEEFQQLVDAGHMIEYSRLCMPETS
SSTPPLSKPVGNLYGTSKKALNTVLACNRVVLMDTDLLGAINIRRYCSREVASTSPVTVS
RAQRSIVQHDGGAAPAAQAPLTLSTPRHVAVSVENEHAAVLMSAYSSKDSILSSSPSCAA
PAVTRTLRCMIIFIAPPSMQVLEQRLRERKTETEASIQLRMTLNRQWMQWARENQSFFDH
YIVNDHLDLCYAKVKEIVRAEVLMVESTL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtggcaccgaaagcgccaatgccggcgatttcatcggttgccgccgcgtctgct
gcccgcaaagcttctcagcaggctgtggggcctctcaagggcactgtcgccctcaggcgc
ctcgtggacgtgcttttgttcgtagggccaagcggctgtggcaagtctacggtgattcgc
cggctgcagcgcgactggcccacgctatttgagttcagcgtgagccacacaacccgttgc
ccgcggcccggcgaggtgcatgggcagcactactacttcgtcaccatggaggagtttcag
cagctggtcgacgcgggtcacatgattgaatactcgcggctctgcatgcccgaaacgtcg
tcgtcgacgcctccgctgagcaagccagtcggcaacctctacgggactagcaagaaagcc
ctgaacacggtgctcgcgtgcaatcgtgtcgtgctcatggacacggatctgctcggcgcc
atcaacattcggcgctattgctctcgtgaggtggcgagcacgagtccggtgaccgtttcg
cgagcgcagcgcagtatagtgcagcacgacggcggcgccgctccggccgcgcaggctccg
ctaaccctctccacacctcggcacgtggccgtctctgtggagaacgagcacgccgcggtc
ctcatgagtgcgtattcatccaaggattcgatattgtcgtcgtccccttcctgtgctgca
cccgcggtcacacgcacgctgcgctgcatgatcatcttcatcgcgccacctagcatgcag
gtgttggagcagcggctgcgagaacgcaagactgaaacggaagcgtcgattcagctgcgc
atgacgctaaatcggcagtggatgcagtgggccagggagaatcagtcgttctttgaccac
tacatcgtgaacgaccaccttgatctctgctacgccaaggtgaaggagattgtgcgggca
gaggtgctcatggtggagagcactctgtga

DBGET integrated database retrieval system