KEGG   Leishmania major: LMJF_36_2260Help
Entry
LMJF_36_2260      CDS       T01014                                 

Definition
guanylate kinase-like protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lma  Leishmania major
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lma00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LMJF_36_2260
Enzymes [BR:lma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LMJF_36_2260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
36:904028..905017
Genome map
AA seq 329 aa AA seqDB search
MSVAPKAPMPAISSVAAASAARKASQQAVGPLKGTVALRRLVDVLLFVGPSGCGKSTVIR
RLQRDWPTLFEFSVSHTTRCPRPGEVHGQHYYFVTMEEFQQLVDAGHMIEYSRLCMPETS
SSTPPLSKPVGNLYGTSKKALNTVLACNRVVLMDTDLLGAINIRRYCSREVASTSPVTVS
RAQRSIVQHDGGAAPAAQAPLTLSTPRHVAVSVENEHAAVLMSAYSSKDSILSSSPSCAA
PAVTRTLRCMIIFIAPPSMQVLEQRLRERKTETEASIQLRMTLNRQWMQWARENQSFFDH
YIVNDHLDLCYAKVKEIVRAEVLMVESTL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtggcaccgaaagcgccaatgccggcgatttcatcggttgccgccgcgtctgct
gcccgcaaagcttctcagcaggctgtggggcctctcaagggcactgtcgccctcaggcgc
ctcgtggacgtgcttttgttcgtagggccaagcggctgtggcaagtctacggtgattcgc
cggctgcagcgcgactggcccacgctatttgagttcagcgtgagccacacaacccgttgc
ccgcggcccggcgaggtgcatgggcagcactactacttcgtcaccatggaggagtttcag
cagctggtcgacgcgggtcacatgattgaatactcgcggctctgcatgcccgaaacgtcg
tcgtcgacgcctccgctgagcaagccagtcggcaacctctacgggactagcaagaaagcc
ctgaacacggtgctcgcgtgcaatcgtgtcgtgctcatggacacggatctgctcggcgcc
atcaacattcggcgctattgctctcgtgaggtggcgagcacgagtccggtgaccgtttcg
cgagcgcagcgcagtatagtgcagcacgacggcggcgccgctccggccgcgcaggctccg
ctaaccctctccacacctcggcacgtggccgtctctgtggagaacgagcacgccgcggtc
ctcatgagtgcgtattcatccaaggattcgatattgtcgtcgtccccttcctgtgctgca
cccgcggtcacacgcacgctgcgctgcatgatcatcttcatcgcgccacctagcatgcag
gtgttggagcagcggctgcgagaacgcaagactgaaacggaagcgtcgattcagctgcgc
atgacgctaaatcggcagtggatgcagtgggccagggagaatcagtcgttctttgaccac
tacatcgtgaacgaccaccttgatctctgctacgccaaggtgaaggagattgtgcgggca
gaggtgctcatggtggagagcactctgtga

DBGET integrated database retrieval system