KEGG   Leishmania major: LMJF_36_2660Help
Entry
LMJF_36_2660      CDS       T01014                                 

Definition
putative dihydrolipoamide acetyltransferase precursor
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lma  Leishmania major
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LMJF_36_2660
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMJF_36_2660
   00020 Citrate cycle (TCA cycle)
    LMJF_36_2660
   00620 Pyruvate metabolism
    LMJF_36_2660
Enzymes [BR:lma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LMJF_36_2660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
36:complement(1088003..1089394)
Genome map
AA seq 463 aa AA seqDB search
MLRCRAVSKLATLAALRFLTITPIPMPALSPTMEKGKITEWCKQPGDFIRPGDTFCNIET
DKAVVSYDNATEEGFFARVITSPGEETVVGQTVCLIVDEKEGVHSDEVKNWKPEAEEAPA
AAAEEAPAAPAATTPVAAAPVAASGDRVKASPYARKMAAEKNVSLRGIKGTGGGVGRITS
KDVAAAVASGTASSAAEVAAPAKTAATAALAAPAKPAAAKGTPPANPNFTDIPVTTMRSV
IAKRLHQSKNLEIPHYYLFDDCRVDNMLALIKQLNAKGNGEYKITVNDYIVKAVARANTL
VPEVNSSWQGDFIRQYATVDVSVAVATPTGLITPIIRNAQAKGLVEISKETKALAKKARD
GTLQPSEFQGGTCSVSNLGATGIPGFTAIINPPQAMILAVGSAKPRAEIVKSEETGEFEM
TGRVENVVSFSASFDHRIVDGALGAKWFQHFHDAMENPLSLLL
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgctccgctgccgtgctgtctcgaagctggccacgctggccgcccttcgcttcctcacc
atcaccccgattcccatgcccgcgctctcccccactatggagaagggcaagatcacggag
tggtgcaagcagcctggtgacttcattcgccccggcgacaccttctgcaacatcgagacc
gataaggctgtcgtgtcgtacgataatgcaactgaagagggcttcttcgcccgcgtcatc
acctctcctggcgaggagacggttgtgggtcagacagtgtgcctcatcgtcgacgagaag
gagggtgtccactctgacgaggtcaagaactggaagcctgaggccgaggaagcacccgct
gcggctgccgaggaggctcctgctgcccctgccgctacaacccctgtggctgctgcccct
gtggcggcgtctggtgaccgcgtgaaggcatcgccgtacgctcgcaagatggctgcggag
aagaacgtttcactgagaggcatcaagggcaccggtggtggtgtgggtcgcatcacgtcc
aaggacgtggcggctgccgtggcaagcggcaccgccagctcggctgcagaggtggctgca
ccggccaagactgctgctactgcggcactggctgcccccgcgaagcccgcggcagccaag
ggaacgcctccagcgaaccccaacttcaccgacattccggtgacgacaatgcgatctgtc
atcgcgaagcgcctgcaccagtccaagaacctggaaattccgcactactacctcttcgac
gactgccgcgtcgacaacatgctggccctcatcaagcagctgaacgcgaaaggtaatggc
gagtacaagatcactgtgaacgactacattgtcaaggcggttgcgcgcgccaacactctg
gtgccggaggtgaactcctcctggcagggtgacttcatccgccagtacgccaccgttgac
gtctcggtggctgtggccacgccgactggcctcattaccccgatcatccgcaacgcgcag
gcgaagggtctcgtagaaatatcgaaggagacgaaggctctagcgaagaaggcgcgcgac
ggtacgctgcagcccagcgagttccagggtggcacgtgctccgtgtcgaacctcggtgcc
acaggcatccccggcttcacagccatcatcaatcccccgcaggcgatgattctcgccgta
ggctccgccaagccgcgcgctgagattgtgaagagcgaggagacgggcgagtttgagatg
actggcagggtagagaacgtcgtgagcttttcggcgtcctttgaccaccgcatcgtcgat
ggcgccctcggcgccaagtggttccagcacttccatgacgccatggagaacccgctgtca
cttctgctgtag

DBGET integrated database retrieval system